<?xml version="1.0"?>
<feed xmlns="http://www.w3.org/2005/Atom" xml:lang="en">
	<id>https://gswiki.play.net/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=SYNATHAESIA</id>
	<title>GemStone IV Wiki - User contributions [en]</title>
	<link rel="self" type="application/atom+xml" href="https://gswiki.play.net/api.php?action=feedcontributions&amp;feedformat=atom&amp;user=SYNATHAESIA"/>
	<link rel="alternate" type="text/html" href="https://gswiki.play.net/Special:Contributions/SYNATHAESIA"/>
	<updated>2026-05-15T18:05:43Z</updated>
	<subtitle>User contributions</subtitle>
	<generator>MediaWiki 1.39.12</generator>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144651</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144651"/>
		<updated>2021-02-13T19:59:10Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Get Thee Behind Me|Get Thee Behind Me]]=={{#section:BVShop:Get Thee Behind Me|2021Q1}}&lt;br /&gt;
==[[BVShop:In Your Element|In Your Element]]=={{#section:BVShop:In Your Element|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2020Q3}}&lt;br /&gt;
==[[BVShop:Potation Parlor|Potation Parlor]]=={{#section:BVShop:Potation Parlor|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2020Q3}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:The Vaalin Rose|The Vaalin Rose]]=={{#section:BVShop:The Vaalin Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2020Q3}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, map room, lich room, and shop ADJECTIVE AND NOUN for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&amp;lt;!-- not open but on shop list--&amp;gt;&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144648</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144648"/>
		<updated>2021-02-13T19:55:00Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Get Thee Behind Me|Get Thee Behind Me]]=={{#section:BVShop:Get Thee Behind Me|2021Q1}}&lt;br /&gt;
==[[BVShop:In Your Element|In Your Element]]=={{#section:BVShop:In Your Element|2021Q1}}&lt;br /&gt;
==[[BVShop:Potation Parlor|Potation Parlor]]=={{#section:BVShop:Potation Parlor|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2020Q3}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:The Vaalin Rose|The Vaalin Rose]]=={{#section:BVShop:The Vaalin Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2020Q3}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, map room, lich room, and shop ADJECTIVE AND NOUN for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&amp;lt;!-- not open but on shop list--&amp;gt;&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:The_Vaalin_Rose&amp;diff=144646</id>
		<title>BVShop:The Vaalin Rose</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:The_Vaalin_Rose&amp;diff=144646"/>
		<updated>2021-02-13T19:54:12Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__TOC__&lt;br /&gt;
&amp;lt;!-- begin wiki output --&amp;gt;&lt;br /&gt;
&amp;lt;!-- Shop:The_Vaalin_Rose --&amp;gt;&lt;br /&gt;
&amp;lt;!--__TOC__--&amp;gt;&lt;br /&gt;
==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Vaalin Rose&lt;br /&gt;
|look=a large veniom-plated airship&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 12], Lich# 26884, go airship&lt;br /&gt;
|fest=dr|year=2021|letter=V}}&lt;br /&gt;
===The Vaalin Rose, Cargo Hold===&amp;lt;!--==={{{ [The Vaalin Rose, Cargo Hold]  2021-02-13 15:10:27 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Vaalin Rose, Cargo Hold - &lt;br /&gt;
|desc=Polished oak beams frame out the spacious cargo hold, their lengths carved with various symbols and images.  Several large iron racks displaying various pieces of armor line one side of the room while sealed boxes and crates are piled on the other.  The light from a trio of dark bronze lanterns casts a pale glow on the collection of items for sale.  You also see a polished oak gangplank.&lt;br /&gt;
|exits= south}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the Several large iron racks you see:||contents= a polished eahnor jazerant with silver-sheened links, a vaalorn jazerant dyed a pale golden, a polished vaalorn chain tunic patterned with contrasting silver, a brushed eahnor haubergeon with pale quilted padding, a double-linked vaalorn chain shirt lined with ebon silk, an eahnor-linked chain corslet reinforced with silver studding, some polished vaalorn splint armor etched with tiny flames, some eahnor-layered scalemail arranged in a viperskin pattern, some eahnor studded splint leather embossed with ebon accents and some vaalorn studded lamellar armor with dark inserts.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a polished eahnor jazerant with silver-sheened links || Weight: 21 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented chain ([[Armor#Spell_Hindrance|AsG]] 15)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolishedeahnorjazerantwithsilver-sheenedlinks&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolishedeahnorjazerantwithsilver-sheenedlinks&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor jazerant and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor jazerant to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a vaalorn jazerant dyed a pale golden || Weight: 23 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented chain ([[Armor#Spell_Hindrance|AsG]] 15)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avaalornjazerantdyedapalegolden&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avaalornjazerantdyedapalegolden&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn jazerant and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn jazerant to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a polished vaalorn chain tunic patterned with contrasting silver || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| double chain ([[Armor#Spell_Hindrance|AsG]] 14)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolishedvaalornchaintunicpatternedwithcontrastingsilver&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolishedvaalornchaintunicpatternedwithcontrastingsilver&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn chain tunic and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn chain tunic to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a brushed eahnor haubergeon with pale quilted padding || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| double chain ([[Armor#Spell_Hindrance|AsG]] 14)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abrushedeahnorhaubergeonwithpalequiltedpadding&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abrushedeahnorhaubergeonwithpalequiltedpadding&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor haubergeon and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor haubergeon to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a double-linked vaalorn chain shirt lined with ebon silk || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain mail ([[Armor#Spell_Hindrance|AsG]] 13)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adouble-linkedvaalornchainshirtlinedwithebonsilk&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adouble-linkedvaalornchainshirtlinedwithebonsilk&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn chain shirt and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn chain shirt to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| an eahnor-linked chain corslet reinforced with silver studding || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain mail ([[Armor#Spell_Hindrance|AsG]] 13)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aneahnor-linkedchaincorsletreinforcedwithsilverstudding&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aneahnor-linkedchaincorsletreinforcedwithsilverstudding&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the chain corslet and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the chain corslet to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some polished vaalorn splint armor etched with tiny flames || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| brigandine armor ([[Armor#Spell_Hindrance|AsG]] 12)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somepolishedvaalornsplintarmoretchedwithtinyflames&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somepolishedvaalornsplintarmoretchedwithtinyflames&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn splint armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn splint armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some eahnor-layered scalemail arranged in a viperskin pattern || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| brigandine armor ([[Armor#Spell_Hindrance|AsG]] 12)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someeahnor-layeredscalemailarrangedinaviperskinpattern&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someeahnor-layeredscalemailarrangedinaviperskinpattern&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor-layered scalemail and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor-layered scalemail to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some eahnor studded splint leather embossed with ebon accents || Weight: 16 pounds &amp;lt;br&amp;gt;Enchant: +18|| studded leather ([[Armor#Spell_Hindrance|AsG]] 11)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someeahnorstuddedsplintleatherembossedwithebonaccents&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someeahnorstuddedsplintleatherembossedwithebonaccents&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the studded splint leather and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the studded splint leather to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some vaalorn studded lamellar armor with dark inserts || Weight: 18 pounds &amp;lt;br&amp;gt;Enchant: +18|| studded leather ([[Armor#Spell_Hindrance|AsG]] 11)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somevaalornstuddedlamellararmorwithdarkinserts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somevaalornstuddedlamellararmorwithdarkinserts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the lamellar armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the lamellar armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Vaalin Rose&lt;br /&gt;
|look=a large veniom-plated airship&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 12], Lich# &amp;lt;room # outside shop&amp;gt;, go south&lt;br /&gt;
|fest=dr|year=2021|letter=V}}&lt;br /&gt;
===The Vaalin Rose, Cargo Hold===&amp;lt;!--==={{{ [The Vaalin Rose, Cargo Hold]  2021-02-13 15:13:38 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Vaalin Rose, Cargo Hold - &lt;br /&gt;
|desc=Stacks of unopened crates, boxes, and barrels line the walls of the massive hold.  Tucked away in a corner is a small wooden table.  Several large iron stands are placed down the center showing off their wares.  Narrow beams of light, shifting through a grate above, shed fractured illumination over the area.&lt;br /&gt;
|exits= north}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the small wooden table you see:||contents= an ebon elven armor certificate, a green elven armor certificate and a blue elven armor certificate.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| an ebon elven armor certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anebonelvenarmorcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebonelvenarmorcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The elven armor certificate will upgrade Elven Armor from tier 3 to 4.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the elven armor certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This will unlock and advance your elven armor by one tier.  This waiver will take it from tier 3 to tier 4.  This certificate will ONLY work if your item is already unlocked to tier 3.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 120,000&lt;br /&gt;
|-&lt;br /&gt;
| a green elven armor certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agreenelvenarmorcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agreenelvenarmorcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The elven armor certificate will upgrade Elven Armor from tier 2 to 3.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the elven armor certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This will unlock and advance your elven armor by one tier.  This waiver will take it from tier 2 to tier 3.  This certificate will ONLY work if your item is already unlocked to tier 2.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50,000&lt;br /&gt;
|-&lt;br /&gt;
| a blue elven armor certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablueelvenarmorcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablueelvenarmorcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The elven armor certificate will upgrade Elven Armor from tier 1 to 2.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the elven armor certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This will unlock and advance your elven armor by one tier.  This waiver will take it from tier 1 to tier 2.  This certificate will ONLY work if your item isn&#039;t unlocked yet.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the Several large iron stands you see:||contents= a suit of eahnor body armor inlaid with slivers of obsidian, a suit of vaalorn plate armor etched with a blooming rose, some polished vaalorn half-plate etched with a flying wyvern, some eahnor plate with alabaster steel rivets, an etched vaalorn breastplate patterned with light markings, a dark eahnor coracia set with pale jade, an ebon-sheened vaalorn cuirass with golden pauldrons, a hammered eahnor plate corslet etched with a large starburst, some fitted eahnor body armor belted with alabaster leather and a vaalorn jazerant hauberk with ebon-trimmed leather.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a suit of eahnor body armor inlaid with slivers of obsidian || Weight: 60 pounds &amp;lt;br&amp;gt;Enchant: +18|| full plate ([[Armor#Spell_Hindrance|AsG]] 20)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asuitofeahnorbodyarmorinlaidwithsliversofobsidian&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asuitofeahnorbodyarmorinlaidwithsliversofobsidian&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor body armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor body armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a suit of vaalorn plate armor etched with a blooming rose || Weight: 60 pounds &amp;lt;br&amp;gt;Enchant: +18|| full plate ([[Armor#Spell_Hindrance|AsG]] 20)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asuitofvaalornplatearmoretchedwithabloomingrose&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asuitofvaalornplatearmoretchedwithabloomingrose&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn plate armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn plate armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some polished vaalorn half-plate etched with a flying wyvern || Weight: 45 pounds &amp;lt;br&amp;gt;Enchant: +18|| half plate ([[Armor#Spell_Hindrance|AsG]] 19)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somepolishedvaalornhalf-plateetchedwithaflyingwyvern&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somepolishedvaalornhalf-plateetchedwithaflyingwyvern&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn half-plate and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn half-plate to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some eahnor plate with alabaster steel rivets || Weight: 40 pounds &amp;lt;br&amp;gt;Enchant: +18|| half plate ([[Armor#Spell_Hindrance|AsG]] 19)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someeahnorplatewithalabastersteelrivets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someeahnorplatewithalabastersteelrivets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor plate and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor plate to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| an etched vaalorn breastplate patterned with light markings || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented plate ([[Armor#Spell_Hindrance|AsG]] 18)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anetchedvaalornbreastplatepatternedwithlightmarkings&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anetchedvaalornbreastplatepatternedwithlightmarkings&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn breastplate and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn breastplate to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a dark eahnor coracia set with pale jade || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented plate ([[Armor#Spell_Hindrance|AsG]] 18)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adarkeahnorcoraciasetwithpalejade&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adarkeahnorcoraciasetwithpalejade&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor coracia and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor coracia to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| an ebon-sheened vaalorn cuirass with golden pauldrons || Weight: 21 pounds &amp;lt;br&amp;gt;Enchant: +18|| metal breastplate ([[Armor#Spell_Hindrance|AsG]] 17)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anebon-sheenedvaalorncuirasswithgoldenpauldrons&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebon-sheenedvaalorncuirasswithgoldenpauldrons&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn cuirass and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn cuirass to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a hammered eahnor plate corslet etched with a large starburst || Weight: 18 pounds &amp;lt;br&amp;gt;Enchant: +18|| metal breastplate ([[Armor#Spell_Hindrance|AsG]] 17)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ahammeredeahnorplatecorsletetchedwithalargestarburst&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ahammeredeahnorplatecorsletetchedwithalargestarburst&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor plate corslet and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor plate corslet to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some fitted eahnor body armor belted with alabaster leather || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain hauberk ([[Armor#Spell_Hindrance|AsG]] 16)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somefittedeahnorbodyarmorbeltedwithalabasterleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somefittedeahnorbodyarmorbeltedwithalabasterleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor body armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor body armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a vaalorn jazerant hauberk with ebon-trimmed leather || Weight: 24 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain hauberk ([[Armor#Spell_Hindrance|AsG]] 16)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avaalornjazeranthauberkwithebon-trimmedleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avaalornjazeranthauberkwithebon-trimmedleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the jazerant hauberk and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the jazerant hauberk to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;br /&gt;
[[Category:Bloodriven Village Shops]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144645</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144645"/>
		<updated>2021-02-13T19:51:30Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Get Thee Behind Me|Get Thee Behind Me]]=={{#section:BVShop:Get Thee Behind Me|2021Q1}}&lt;br /&gt;
==[[BVShop:In Your Element|In Your Element]]=={{#section:BVShop:In Your Element|2021Q1}}&lt;br /&gt;
==[[BVShop:Potation Parlor|Potation Parlor]]=={{#section:BVShop:Potation Parlor|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:The Vaalin Rose|The Vaalin Rose]]=={{#section:BVShop:The Vaalin Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2020Q3}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, map room, lich room, and shop ADJECTIVE AND NOUN for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&amp;lt;!-- not open but on shop list--&amp;gt;&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:The_Vaalin_Rose&amp;diff=144644</id>
		<title>BVShop:The Vaalin Rose</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:The_Vaalin_Rose&amp;diff=144644"/>
		<updated>2021-02-13T19:49:24Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: Created page with &amp;quot;__TOC__ &amp;lt;!-- begin wiki output --&amp;gt; &amp;lt;!-- Shop:The_Vaalin_Rose --&amp;gt; &amp;lt;!--__TOC__--&amp;gt; ==2021Q1== &amp;lt;section begin=2021Q1 /&amp;gt; {{Festshop |shopname=The Vaalin Rose |look=a large veniom-p...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__TOC__&lt;br /&gt;
&amp;lt;!-- begin wiki output --&amp;gt;&lt;br /&gt;
&amp;lt;!-- Shop:The_Vaalin_Rose --&amp;gt;&lt;br /&gt;
&amp;lt;!--__TOC__--&amp;gt;&lt;br /&gt;
==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Vaalin Rose&lt;br /&gt;
|look=a large veniom-plated airship&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 12], Lich# 26884, go airship&lt;br /&gt;
|fest=dr|year=2021|letter=V}}&lt;br /&gt;
===The Vaalin Rose, Cargo Hold===&amp;lt;!--==={{{ [The Vaalin Rose, Cargo Hold]  2021-02-13 15:10:27 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Vaalin Rose, Cargo Hold - &lt;br /&gt;
|desc=Polished oak beams frame out the spacious cargo hold, their lengths carved with various symbols and images.  Several large iron racks displaying various pieces of armor line one side of the room while sealed boxes and crates are piled on the other.  The light from a trio of dark bronze lanterns casts a pale glow on the collection of items for sale.  You also see a polished oak gangplank.&lt;br /&gt;
|exits= south}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the Several large iron racks you see:||contents= a polished eahnor jazerant with silver-sheened links, a vaalorn jazerant dyed a pale golden, a polished vaalorn chain tunic patterned with contrasting silver, a brushed eahnor haubergeon with pale quilted padding, a double-linked vaalorn chain shirt lined with ebon silk, an eahnor-linked chain corslet reinforced with silver studding, some polished vaalorn splint armor etched with tiny flames, some eahnor-layered scalemail arranged in a viperskin pattern, some eahnor studded splint leather embossed with ebon accents and some vaalorn studded lamellar armor with dark inserts.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a polished eahnor jazerant with silver-sheened links || Weight: 21 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented chain ([[Armor#Spell_Hindrance|AsG]] 15)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolishedeahnorjazerantwithsilver-sheenedlinks&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolishedeahnorjazerantwithsilver-sheenedlinks&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor jazerant and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor jazerant to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a vaalorn jazerant dyed a pale golden || Weight: 23 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented chain ([[Armor#Spell_Hindrance|AsG]] 15)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avaalornjazerantdyedapalegolden&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avaalornjazerantdyedapalegolden&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn jazerant and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn jazerant to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a polished vaalorn chain tunic patterned with contrasting silver || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| double chain ([[Armor#Spell_Hindrance|AsG]] 14)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolishedvaalornchaintunicpatternedwithcontrastingsilver&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolishedvaalornchaintunicpatternedwithcontrastingsilver&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn chain tunic and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn chain tunic to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a brushed eahnor haubergeon with pale quilted padding || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| double chain ([[Armor#Spell_Hindrance|AsG]] 14)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abrushedeahnorhaubergeonwithpalequiltedpadding&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abrushedeahnorhaubergeonwithpalequiltedpadding&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor haubergeon and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor haubergeon to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a double-linked vaalorn chain shirt lined with ebon silk || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain mail ([[Armor#Spell_Hindrance|AsG]] 13)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adouble-linkedvaalornchainshirtlinedwithebonsilk&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adouble-linkedvaalornchainshirtlinedwithebonsilk&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn chain shirt and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn chain shirt to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| an eahnor-linked chain corslet reinforced with silver studding || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain mail ([[Armor#Spell_Hindrance|AsG]] 13)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aneahnor-linkedchaincorsletreinforcedwithsilverstudding&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aneahnor-linkedchaincorsletreinforcedwithsilverstudding&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the chain corslet and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the chain corslet to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some polished vaalorn splint armor etched with tiny flames || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| brigandine armor ([[Armor#Spell_Hindrance|AsG]] 12)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somepolishedvaalornsplintarmoretchedwithtinyflames&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somepolishedvaalornsplintarmoretchedwithtinyflames&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn splint armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn splint armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some eahnor-layered scalemail arranged in a viperskin pattern || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| brigandine armor ([[Armor#Spell_Hindrance|AsG]] 12)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someeahnor-layeredscalemailarrangedinaviperskinpattern&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someeahnor-layeredscalemailarrangedinaviperskinpattern&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor-layered scalemail and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor-layered scalemail to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some eahnor studded splint leather embossed with ebon accents || Weight: 16 pounds &amp;lt;br&amp;gt;Enchant: +18|| studded leather ([[Armor#Spell_Hindrance|AsG]] 11)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someeahnorstuddedsplintleatherembossedwithebonaccents&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someeahnorstuddedsplintleatherembossedwithebonaccents&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the studded splint leather and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the studded splint leather to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some vaalorn studded lamellar armor with dark inserts || Weight: 18 pounds &amp;lt;br&amp;gt;Enchant: +18|| studded leather ([[Armor#Spell_Hindrance|AsG]] 11)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somevaalornstuddedlamellararmorwithdarkinserts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somevaalornstuddedlamellararmorwithdarkinserts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the lamellar armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the lamellar armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Vaalin Rose&lt;br /&gt;
|look=a large veniom-plated airship&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 12], Lich# &amp;lt;room # outside shop&amp;gt;, go south&lt;br /&gt;
|fest=dr|year=2021|letter=V}}&lt;br /&gt;
===The Vaalin Rose, Cargo Hold===&amp;lt;!--==={{{ [The Vaalin Rose, Cargo Hold]  2021-02-13 15:13:38 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Vaalin Rose, Cargo Hold - &lt;br /&gt;
|desc=Stacks of unopened crates, boxes, and barrels line the walls of the massive hold.  Tucked away in a corner is a small wooden table.  Several large iron stands are placed down the center showing off their wares.  Narrow beams of light, shifting through a grate above, shed fractured illumination over the area.&lt;br /&gt;
|exits= north}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the small wooden table you see:||contents= an ebon elven armor certificate, a green elven armor certificate and a blue elven armor certificate.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| an ebon elven armor certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anebonelvenarmorcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebonelvenarmorcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The elven armor certificate will upgrade Elven Armor from tier 3 to 4.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the elven armor certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This will unlock and advance your elven armor by one tier.  This waiver will take it from tier 3 to tier 4.  This certificate will ONLY work if your item is already unlocked to tier 3.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 120,000&lt;br /&gt;
|-&lt;br /&gt;
| a green elven armor certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agreenelvenarmorcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agreenelvenarmorcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The elven armor certificate will upgrade Elven Armor from tier 2 to 3.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the elven armor certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This will unlock and advance your elven armor by one tier.  This waiver will take it from tier 2 to tier 3.  This certificate will ONLY work if your item is already unlocked to tier 2.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50,000&lt;br /&gt;
|-&lt;br /&gt;
| a blue elven armor certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablueelvenarmorcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablueelvenarmorcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The elven armor certificate will upgrade Elven Armor from tier 1 to 2.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the elven armor certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This will unlock and advance your elven armor by one tier.  This waiver will take it from tier 1 to tier 2.  This certificate will ONLY work if your item isn&#039;t unlocked yet.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the Several large iron stands you see:||contents= a suit of eahnor body armor inlaid with slivers of obsidian, a suit of vaalorn plate armor etched with a blooming rose, some polished vaalorn half-plate etched with a flying wyvern, some eahnor plate with alabaster steel rivets, an etched vaalorn breastplate patterned with light markings, a dark eahnor coracia set with pale jade, an ebon-sheened vaalorn cuirass with golden pauldrons, a hammered eahnor plate corslet etched with a large starburst, some fitted eahnor body armor belted with alabaster leather and a vaalorn jazerant hauberk with ebon-trimmed leather.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a suit of eahnor body armor inlaid with slivers of obsidian || Weight: 60 pounds &amp;lt;br&amp;gt;Enchant: +18|| full plate ([[Armor#Spell_Hindrance|AsG]] 20)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asuitofeahnorbodyarmorinlaidwithsliversofobsidian&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asuitofeahnorbodyarmorinlaidwithsliversofobsidian&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor body armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor body armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a suit of vaalorn plate armor etched with a blooming rose || Weight: 60 pounds &amp;lt;br&amp;gt;Enchant: +18|| full plate ([[Armor#Spell_Hindrance|AsG]] 20)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asuitofvaalornplatearmoretchedwithabloomingrose&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asuitofvaalornplatearmoretchedwithabloomingrose&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn plate armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn plate armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some polished vaalorn half-plate etched with a flying wyvern || Weight: 45 pounds &amp;lt;br&amp;gt;Enchant: +18|| half plate ([[Armor#Spell_Hindrance|AsG]] 19)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somepolishedvaalornhalf-plateetchedwithaflyingwyvern&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somepolishedvaalornhalf-plateetchedwithaflyingwyvern&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn half-plate and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn half-plate to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some eahnor plate with alabaster steel rivets || Weight: 40 pounds &amp;lt;br&amp;gt;Enchant: +18|| half plate ([[Armor#Spell_Hindrance|AsG]] 19)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someeahnorplatewithalabastersteelrivets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someeahnorplatewithalabastersteelrivets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor plate and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor plate to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| an etched vaalorn breastplate patterned with light markings || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented plate ([[Armor#Spell_Hindrance|AsG]] 18)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anetchedvaalornbreastplatepatternedwithlightmarkings&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anetchedvaalornbreastplatepatternedwithlightmarkings&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn breastplate and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn breastplate to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a dark eahnor coracia set with pale jade || Weight: 20 pounds &amp;lt;br&amp;gt;Enchant: +18|| augmented plate ([[Armor#Spell_Hindrance|AsG]] 18)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adarkeahnorcoraciasetwithpalejade&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adarkeahnorcoraciasetwithpalejade&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor coracia and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor coracia to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| an ebon-sheened vaalorn cuirass with golden pauldrons || Weight: 21 pounds &amp;lt;br&amp;gt;Enchant: +18|| metal breastplate ([[Armor#Spell_Hindrance|AsG]] 17)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anebon-sheenedvaalorncuirasswithgoldenpauldrons&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebon-sheenedvaalorncuirasswithgoldenpauldrons&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalorn cuirass and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the vaalorn cuirass to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a hammered eahnor plate corslet etched with a large starburst || Weight: 18 pounds &amp;lt;br&amp;gt;Enchant: +18|| metal breastplate ([[Armor#Spell_Hindrance|AsG]] 17)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ahammeredeahnorplatecorsletetchedwithalargestarburst&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ahammeredeahnorplatecorsletetchedwithalargestarburst&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor plate corslet and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor plate corslet to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| some fitted eahnor body armor belted with alabaster leather || Weight: 22 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain hauberk ([[Armor#Spell_Hindrance|AsG]] 16)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somefittedeahnorbodyarmorbeltedwithalabasterleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somefittedeahnorbodyarmorbeltedwithalabasterleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eahnor body armor and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the eahnor body armor to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a vaalorn jazerant hauberk with ebon-trimmed leather || Weight: 24 pounds &amp;lt;br&amp;gt;Enchant: +18|| chain hauberk ([[Armor#Spell_Hindrance|AsG]] 16)&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avaalornjazeranthauberkwithebon-trimmedleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avaalornjazeranthauberkwithebon-trimmedleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the jazerant hauberk and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is tier 1 Elven Armor.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Tier&amp;lt;br&amp;gt;&lt;br /&gt;
  1: Magic Affinity - Spells cast to permanently improve this armor, such as Enchant or Ensorcell, are more easily incorporated into it.  Those spells gain a +10 bonus per tier to success rolls.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Verbs: bow, clean, push, pull, remove, rub, tap, wear&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&amp;lt;b&amp;gt;You may alter the jazerant hauberk to change its description, but it must NOT ever imply that it was not originally crafted by elves - it was.&amp;lt;/b&amp;gt;&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;br /&gt;
[[Category:Bloodriven Village Shops]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144642</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144642"/>
		<updated>2021-02-13T19:37:17Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Get Thee Behind Me|Get Thee Behind Me]]=={{#section:BVShop:Get Thee Behind Me|2021Q1}}&lt;br /&gt;
==[[BVShop:In Your Element|In Your Element]]=={{#section:BVShop:In Your Element|2021Q1}}&lt;br /&gt;
==[[BVShop:Potation Parlor|Potation Parlor]]=={{#section:BVShop:Potation Parlor|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2020Q3}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&amp;lt;!-- not open but on shop list--&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144640</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144640"/>
		<updated>2021-02-13T19:32:39Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Get Thee Behind Me|Get Thee Behind Me]]=={{#section:BVShop:Get Thee Behind Me|2021Q1}}&lt;br /&gt;
==[[BVShop:In Your Element|In Your Element]]=={{#section:BVShop:In Your Element|2021Q1}}&lt;br /&gt;
==[[BVShop:Potation Parlor|Potation Parlor]]=={{#section:BVShop:Potation Parlor|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&amp;lt;!-- not open but on shop list--&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:In_Your_Element&amp;diff=144638</id>
		<title>BVShop:In Your Element</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:In_Your_Element&amp;diff=144638"/>
		<updated>2021-02-13T19:30:46Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: added category/TOC&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__TOC__&lt;br /&gt;
==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=In Your Element&lt;br /&gt;
|look=a rectangular polychromatic structure&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 9], Lich# 26886, go structure&lt;br /&gt;
|fest=dr|year=2021|letter=I}}&lt;br /&gt;
===In Your Element===&amp;lt;!--==={{{ [In Your Element]  2021-02-13 14:48:38 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=In Your Element - &lt;br /&gt;
|desc=The interior of the building is clearly divided into four quadrants, each one bearing striking symbols and pieces of artwork pertaining to a distinct element.  At the exact center of the room is a pedestal, itself divided into four equal segments.  Torches burn in each of the four quadrants, each illuminating their individual section while also serving to cast light on their neighbors.  Atop the pedestal sits a series of wrought iron hooks.  A heavy drape leads out of the shop.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;polychromatic sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The gloves on the hooks are Elemental Gloves!  These are well-suited for unarmed combat, and they have some extra features as well!  You can use these gloves to fire bolts of elemental energy at targets a limited number of times per day.  Extra uses per day can be purchased from the certificate in the chest.  Note that it is HIGHLY RECOMMENDED that you purchase a set that matches your elemental ATTUNEment, as this will impart rather noticeable advantages in their use.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the series of wrought iron hooks you see:||contents= some threadbare ivory gloves, some russet gloves inlaid with crushed garnets, some ivory gloves inlaid with crushed opals, some cerulean gloves inlaid with crushed sapphires, some russet gloves with sharp-cut garnets on the knuckles, some ivory gloves with sharp-cut opals on the knuckles, some cerulean gloves with sharp-cut sapphires on the knuckles, some russet gloves with deeply flawed garnets in each palm, some ivory gloves with deeply flawed opals in each palm, some cerulean gloves with deeply flawed sapphires in each palm, some threadbare russet gloves, some threadbare cerulean gloves, some threadbare crimson gloves, some crimson gloves with deeply flawed rubies in each palm, some crimson gloves with sharp-cut rubies on the knuckles and some crimson gloves inlaid with crushed rubies.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| some threadbare ivory gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbareivorygloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbareivorygloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some russet gloves inlaid with crushed garnets || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somerussetglovesinlaidwithcrushedgarnets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somerussetglovesinlaidwithcrushedgarnets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some ivory gloves inlaid with crushed opals || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someivoryglovesinlaidwithcrushedopals&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someivoryglovesinlaidwithcrushedopals&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some cerulean gloves inlaid with crushed sapphires || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someceruleanglovesinlaidwithcrushedsapphires&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someceruleanglovesinlaidwithcrushedsapphires&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some russet gloves with sharp-cut garnets on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somerussetgloveswithsharp-cutgarnetsontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somerussetgloveswithsharp-cutgarnetsontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some ivory gloves with sharp-cut opals on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someivorygloveswithsharp-cutopalsontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someivorygloveswithsharp-cutopalsontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some cerulean gloves with sharp-cut sapphires on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someceruleangloveswithsharp-cutsapphiresontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someceruleangloveswithsharp-cutsapphiresontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some russet gloves with deeply flawed garnets in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somerussetgloveswithdeeplyflawedgarnetsineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somerussetgloveswithdeeplyflawedgarnetsineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some ivory gloves with deeply flawed opals in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someivorygloveswithdeeplyflawedopalsineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someivorygloveswithdeeplyflawedopalsineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some cerulean gloves with deeply flawed sapphires in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someceruleangloveswithdeeplyflawedsapphiresineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someceruleangloveswithdeeplyflawedsapphiresineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some threadbare russet gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbarerussetgloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbarerussetgloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some threadbare cerulean gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbareceruleangloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbareceruleangloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some threadbare crimson gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbarecrimsongloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbarecrimsongloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some crimson gloves with deeply flawed rubies in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somecrimsongloveswithdeeplyflawedrubiesineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somecrimsongloveswithdeeplyflawedrubiesineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some crimson gloves with sharp-cut rubies on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somecrimsongloveswithsharp-cutrubiesontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somecrimsongloveswithsharp-cutrubiesontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some crimson gloves inlaid with crushed rubies || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somecrimsonglovesinlaidwithcrushedrubies&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somecrimsonglovesinlaidwithcrushedrubies&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=In the small multicolored chest you see:||contents= a polychromatic tome.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a polychromatic tome || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolychromatictome&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolychromatictome&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your tome is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your tome will unlock Elemental Gloves to be able to activate an extra time per day.  Please note that the maximum number of unlocks is ten.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your tome while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your tome may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the polychromatic tome.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;br /&gt;
[[Category:Bloodriven Village Shops]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Potation_Parlor&amp;diff=144636</id>
		<title>BVShop:Potation Parlor</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Potation_Parlor&amp;diff=144636"/>
		<updated>2021-02-13T19:29:01Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: added category&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Potation Parlor&lt;br /&gt;
|look=a crumbling abandoned building&lt;br /&gt;
|location=[Map Room 8], Lich# 26888, go abandoned building&lt;br /&gt;
|fest=dr|year=2021|letter=P}}&lt;br /&gt;
===Potation Parlor===&amp;lt;!--==={{{ [Potation Parlor]  2021-02-13 14:29:38 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Potation Parlor - &lt;br /&gt;
|desc=Cradled within the frame of an abandoned building, the shop features a scorched mural born from a past fire and shaped into art.  A dingy counter rests against one wall and several stools are available for seating.  An opening in a crumbling wall offers access to the outside.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the dingy counter you see:||contents= a canister of spiced beef soup, a canister of rich chicken soup, a canister of aromatic turtle soup, a canister of warm vegetable broth, a glass of iced raspberry tea, a frosted peach shake, a tall cold glass of lemonade and a painted clay mug of cold chocolate milk.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a canister of spiced beef soup || Weight: &amp;lt;1 pound || || [[Warding Sphere]]&amp;lt;br&amp;gt;10 quaffs || 500&lt;br /&gt;
|-&lt;br /&gt;
| a canister of rich chicken soup || Weight: &amp;lt;1 pound || || [[Prismatic Guard]]&amp;lt;br&amp;gt;10 quaffs || 250&lt;br /&gt;
|-&lt;br /&gt;
| a canister of aromatic turtle soup || Weight: &amp;lt;1 pound || || [[Heroism]]&amp;lt;br&amp;gt;10 quaffs || 750&lt;br /&gt;
|-&lt;br /&gt;
| a canister of warm vegetable broth || Weight: &amp;lt;1 pound || || [[Prayer of Protection]]&amp;lt;br&amp;gt;10 quaffs || 200&lt;br /&gt;
|-&lt;br /&gt;
| a glass of iced raspberry tea || Weight: &amp;lt;1 pound || || [[Strength of Will]]&amp;lt;br&amp;gt;10 quaffs || 500&lt;br /&gt;
|-&lt;br /&gt;
| a frosted peach shake || Weight: &amp;lt;1 pound || || [[Strength]]&amp;lt;br&amp;gt;10 quaffs || 150&lt;br /&gt;
|-&lt;br /&gt;
| tall cold glass of lemonade || Weight: &amp;lt;1 pound || || [[Mobility]]&amp;lt;br&amp;gt;10 quaffs || 300&lt;br /&gt;
|-&lt;br /&gt;
| a painted clay mug of cold chocolate milk || Weight: &amp;lt;1 pound || || [[Elemental Defense III]]&amp;lt;br&amp;gt;10 quaffs || 200&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;br /&gt;
[[Category:Bloodriven Village Shops]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Get_Thee_Behind_Me&amp;diff=144635</id>
		<title>BVShop:Get Thee Behind Me</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Get_Thee_Behind_Me&amp;diff=144635"/>
		<updated>2021-02-13T19:28:11Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: added category&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Get Thee Behind Me&lt;br /&gt;
|look=a soot-darkened fel wagon&lt;br /&gt;
|location=[Map Room 5], Lich# 26897, go fel wagon&lt;br /&gt;
|fest=dr|year=2021|letter=G}}&lt;br /&gt;
===Get Thee Behind Me, Entrance===&amp;lt;!--==={{{ [Get Thee Behind Me]  2021-02-13 14:18:40 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Get Thee Behind Me - &lt;br /&gt;
|desc=Windows line the walls of the wagon, though each is rendered useless by a heavy layer of soot in addition to the shield rack that blocks an entire row itself.  On a small counter beneath one of the windows is a steel-framed note and a dingy oil lamp, and a tattered ivory vellum sign lined with faded script is hooked carelessly over one of the rack&#039;s supports.&lt;br /&gt;
|exits= east, out}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;tattered ivory vellum sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The kidney shield, targe, and buckler will hold a weapon up to 4 pounds.  The heater, parma, and lantern shield will hold a weapon up to 8 pounds.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the small counter you see:||contents= a pale grey parchment certificate.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a pale grey parchment certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apalegreyparchmentcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apalegreyparchmentcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your certificate will unlock a pocketed shield from Tier 1 to Tier 2.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the grey parchment certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This certificate will unlock your shield to tier 2.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the shield rack you see:||contents= a copper-studded verdant mossbark kidney shield, a bronze sigil-branded eahnor targe, a reinforced cross-banded mithril buckler, a gold crown-edged rolaren heater, an ebony bolt-engraved dark mithglin parma and a radially bladed silvery ora lantern shield.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a copper-studded verdant mossbark kidney shield || Weight: 6 pounds &amp;lt;br&amp;gt;Enchant: +20|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acopper-studdedverdantmossbarkkidneyshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acopper-studdedverdantmossbarkkidneyshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of green suede straps and oval copper buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a bronze sigil-branded eahnor targe || Weight: 5 pounds &amp;lt;br&amp;gt;Enchant: +18|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abronzesigil-brandedeahnortarge&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abronzesigil-brandedeahnortarge&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the targe can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This targe is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the targe&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the targe, a complex webbing of crimson suede straps and round bronze buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a reinforced cross-banded mithril buckler || Weight: 5 pounds &amp;lt;br&amp;gt;Enchant: +20|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-areinforcedcross-bandedmithrilbuckler&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-areinforcedcross-bandedmithrilbuckler&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the buckler can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This buckler is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the buckler&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the buckler, a complex webbing of grey leather straps and sturdy square buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a gold crown-edged rolaren heater || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agoldcrown-edgedrolarenheater&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agoldcrown-edgedrolarenheater&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the heater can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This heater is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the heater&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the heater, a complex webbing of gold suede straps and square gold buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| an ebony bolt-engraved dark mithglin parma || Weight: 7 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anebonybolt-engraveddarkmithglinparma&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebonybolt-engraveddarkmithglinparma&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the parma can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This parma is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the parma&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the parma, a complex webbing of black suede straps and heavy square buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a radially bladed silvery ora lantern shield || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aradiallybladedsilveryoralanternshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aradiallybladedsilveryoralanternshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of white suede straps and round silver buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Get Thee Behind Me&lt;br /&gt;
|look=a soot-darkened fel wagon&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 5], Lich# &amp;lt;room # outside shop&amp;gt;, go east&lt;br /&gt;
|fest=dr|year=2021|letter=G}}&lt;br /&gt;
===Get Thee Behind Me, East===&amp;lt;!--==={{{ [Get Thee Behind Me]  2021-02-13 14:21:34 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Get Thee Behind Me - &lt;br /&gt;
|desc=Sparce slivers of light peek in through clear streaks on the sooty windows by virtue of a cleaning job only half-done, and a wall-length shield rack occupies the rear of the wagon.  A tattered ivory vellum sign lined with faded script dangles from a broken peg on the side of the rack.&lt;br /&gt;
|exits= west}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;tattered ivory vellum sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The greatshield, wall shield, and pavis can all hold weapons up to 12 pounds.  The aegis, scutum, and kite shield can hold a weapon up to 10 pounds.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the wall-length shield rack you see:||contents= a scarlet flame-edged golden vaalorn greatshield, a silver wing-etched grey ora wall shield, a knotwork-edged mottled green imflass pavis, a bronze hydra-embossed eahnor aegis, a stud-edged onyx rolaren scutum and a cerulean griffin-crested mithglin kite shield.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a scarlet flame-edged golden vaalorn greatshield || Weight: 11 pounds &amp;lt;br&amp;gt;Enchant: +18|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ascarletflame-edgedgoldenvaalorngreatshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ascarletflame-edgedgoldenvaalorngreatshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the greatshield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This greatshield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the greatshield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the greatshield, a complex webbing of scarlet leather straps and heavy invar buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a silver wing-etched grey ora wall shield || Weight: 12 pounds &amp;lt;br&amp;gt;Enchant: +20|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilverwing-etchedgreyorawallshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilverwing-etchedgreyorawallshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of pale grey suede straps and silver oval buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a knotwork-edged mottled green imflass pavis || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +17|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aknotwork-edgedmottledgreenimflasspavis&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aknotwork-edgedmottledgreenimflasspavis&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the pavis can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This pavis is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the pavis&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the pavis, a complex webbing of green suede straps and square faenor buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a bronze hydra-embossed eahnor aegis || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +18|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abronzehydra-embossedeahnoraegis&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abronzehydra-embossedeahnoraegis&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the aegis can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This aegis is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the aegis&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the aegis, a complex webbing of crimson suede straps and round bronze buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a stud-edged onyx rolaren scutum || Weight: 10 pounds &amp;lt;br&amp;gt;Enchant: +20|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-astud-edgedonyxrolarenscutum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-astud-edgedonyxrolarenscutum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the scutum can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This scutum is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the scutum&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the scutum, a complex webbing of ebony leather straps and heavy black buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a cerulean griffin-crested mithglin kite shield || Weight: 9 pounds &amp;lt;br&amp;gt;Enchant: +20|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aceruleangriffin-crestedmithglinkiteshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aceruleangriffin-crestedmithglinkiteshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of cerulean suede straps and square silver buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
[[Category:Bloodriven Village Shops]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:In_Your_Element&amp;diff=144633</id>
		<title>BVShop:In Your Element</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:In_Your_Element&amp;diff=144633"/>
		<updated>2021-02-13T19:26:26Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: Created page with &amp;quot;__TOC__ ==2021Q1== &amp;lt;section begin=2021Q1 /&amp;gt; {{Festshop |shopname=In Your Element |look=a rectangular polychromatic structure&amp;lt;!--#shop look, the outside: e.g. crumbling two-sto...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__TOC__&lt;br /&gt;
==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=In Your Element&lt;br /&gt;
|look=a rectangular polychromatic structure&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 9], Lich# 26886, go structure&lt;br /&gt;
|fest=dr|year=2021|letter=I}}&lt;br /&gt;
===In Your Element===&amp;lt;!--==={{{ [In Your Element]  2021-02-13 14:48:38 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=In Your Element - &lt;br /&gt;
|desc=The interior of the building is clearly divided into four quadrants, each one bearing striking symbols and pieces of artwork pertaining to a distinct element.  At the exact center of the room is a pedestal, itself divided into four equal segments.  Torches burn in each of the four quadrants, each illuminating their individual section while also serving to cast light on their neighbors.  Atop the pedestal sits a series of wrought iron hooks.  A heavy drape leads out of the shop.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;polychromatic sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The gloves on the hooks are Elemental Gloves!  These are well-suited for unarmed combat, and they have some extra features as well!  You can use these gloves to fire bolts of elemental energy at targets a limited number of times per day.  Extra uses per day can be purchased from the certificate in the chest.  Note that it is HIGHLY RECOMMENDED that you purchase a set that matches your elemental ATTUNEment, as this will impart rather noticeable advantages in their use.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the series of wrought iron hooks you see:||contents= some threadbare ivory gloves, some russet gloves inlaid with crushed garnets, some ivory gloves inlaid with crushed opals, some cerulean gloves inlaid with crushed sapphires, some russet gloves with sharp-cut garnets on the knuckles, some ivory gloves with sharp-cut opals on the knuckles, some cerulean gloves with sharp-cut sapphires on the knuckles, some russet gloves with deeply flawed garnets in each palm, some ivory gloves with deeply flawed opals in each palm, some cerulean gloves with deeply flawed sapphires in each palm, some threadbare russet gloves, some threadbare cerulean gloves, some threadbare crimson gloves, some crimson gloves with deeply flawed rubies in each palm, some crimson gloves with sharp-cut rubies on the knuckles and some crimson gloves inlaid with crushed rubies.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| some threadbare ivory gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbareivorygloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbareivorygloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some russet gloves inlaid with crushed garnets || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somerussetglovesinlaidwithcrushedgarnets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somerussetglovesinlaidwithcrushedgarnets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some ivory gloves inlaid with crushed opals || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someivoryglovesinlaidwithcrushedopals&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someivoryglovesinlaidwithcrushedopals&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some cerulean gloves inlaid with crushed sapphires || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someceruleanglovesinlaidwithcrushedsapphires&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someceruleanglovesinlaidwithcrushedsapphires&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some russet gloves with sharp-cut garnets on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somerussetgloveswithsharp-cutgarnetsontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somerussetgloveswithsharp-cutgarnetsontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some ivory gloves with sharp-cut opals on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someivorygloveswithsharp-cutopalsontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someivorygloveswithsharp-cutopalsontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some cerulean gloves with sharp-cut sapphires on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someceruleangloveswithsharp-cutsapphiresontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someceruleangloveswithsharp-cutsapphiresontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some russet gloves with deeply flawed garnets in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somerussetgloveswithdeeplyflawedgarnetsineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somerussetgloveswithdeeplyflawedgarnetsineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some ivory gloves with deeply flawed opals in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someivorygloveswithdeeplyflawedopalsineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someivorygloveswithdeeplyflawedopalsineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the ivory gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves are attuned to &amp;lt;b&amp;gt;lightning&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These ivory gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some cerulean gloves with deeply flawed sapphires in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-someceruleangloveswithdeeplyflawedsapphiresineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-someceruleangloveswithdeeplyflawedsapphiresineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some threadbare russet gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: impact (earth)|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbarerussetgloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbarerussetgloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the russet gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves are attuned to &amp;lt;b&amp;gt;earth&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These russet gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some threadbare cerulean gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: ice|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbareceruleangloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbareceruleangloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the cerulean gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves are attuned to &amp;lt;b&amp;gt;water&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These cerulean gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some threadbare crimson gloves || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somethreadbarecrimsongloves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somethreadbarecrimsongloves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some crimson gloves with deeply flawed rubies in each palm || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somecrimsongloveswithdeeplyflawedrubiesineachpalm&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somecrimsongloveswithdeeplyflawedrubiesineachpalm&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some crimson gloves with sharp-cut rubies on the knuckles || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somecrimsongloveswithsharp-cutrubiesontheknuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somecrimsongloveswithsharp-cutrubiesontheknuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
| some crimson gloves inlaid with crushed rubies || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| UAC gloves&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-somecrimsonglovesinlaidwithcrushedrubies&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-somecrimsonglovesinlaidwithcrushedrubies&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson gloves and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
These are &amp;quot;Elemental Gloves&amp;quot;, and are intended to be UCS Equipment which allows for temporary SMRv2 attacks a certain number of times per day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Alteration instructions:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves MUST remain gloves (the noun cannot be changed for any reason, or the script will fail).  While the script can handle alterations aside from that (to include a SHOW), it&#039;s important to note that the script will always show (and use in the messaging) a buckle used to cinch the gloves around the wrist.  This means no forearm- or elbow-length gloves.  The material of the buckle can be changed by any merchant willing to do so.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves are attuned to &amp;lt;b&amp;gt;fire&amp;lt;/b&amp;gt;.  If your elemental ATTUNEment matches this, then your gloves will be more mechanically effective.  Note that water attunement syncs with cold flares, and both air and lightning attunement sync with electricity flares.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These gloves can be activated 1 time a day using CLENCH.  When activated, the gloves can execute elemental attacks using WAVE.  This ability remains active for 45 seconds.  Once the last charge has been expended,  the gloves will be fully recharged the following day.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;These crimson gloves currently have 1 charge remaining.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;SNAP and CLAP are fluff verbs which only function when the wearer&#039;s attunement matches the element of the gloves.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=In the small multicolored chest you see:||contents= a polychromatic tome.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a polychromatic tome || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolychromatictome&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolychromatictome&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your tome is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your tome will unlock Elemental Gloves to be able to activate an extra time per day.  Please note that the maximum number of unlocks is ten.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your tome while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your tome may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the polychromatic tome.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Potation_Parlor&amp;diff=144630</id>
		<title>BVShop:Potation Parlor</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Potation_Parlor&amp;diff=144630"/>
		<updated>2021-02-13T19:20:55Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: changed current to 2021Q1&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Potation Parlor&lt;br /&gt;
|look=a crumbling abandoned building&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 8], Lich# 26888, go abandoned building&lt;br /&gt;
|fest=dr|year=2021|letter=P}}&lt;br /&gt;
===Potation Parlor===&amp;lt;!--==={{{ [Potation Parlor]  2021-02-13 14:29:38 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Potation Parlor - &lt;br /&gt;
|desc=Cradled within the frame of an abandoned building, the shop features a scorched mural born from a past fire and shaped into art.  A dingy counter rests against one wall and several stools are available for seating.  An opening in a crumbling wall offers access to the outside.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the dingy counter you see:||contents= a canister of spiced beef soup, a canister of rich chicken soup, a canister of aromatic turtle soup, a canister of warm vegetable broth, a glass of iced raspberry tea, a frosted peach shake, a tall cold glass of lemonade and a painted clay mug of cold chocolate milk.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a canister of spiced beef soup || Weight: &amp;lt;1 pound || || [[Warding Sphere]]&amp;lt;br&amp;gt;10 quaffs || 500&lt;br /&gt;
|-&lt;br /&gt;
| a canister of rich chicken soup || Weight: &amp;lt;1 pound || || [[Prismatic Guard]]&amp;lt;br&amp;gt;10 quaffs || 250&lt;br /&gt;
|-&lt;br /&gt;
| a canister of aromatic turtle soup || Weight: &amp;lt;1 pound || || [[Heroism]]&amp;lt;br&amp;gt;10 quaffs || 750&lt;br /&gt;
|-&lt;br /&gt;
| a canister of warm vegetable broth || Weight: &amp;lt;1 pound || || [[Prayer of Protection]]&amp;lt;br&amp;gt;10 quaffs || 200&lt;br /&gt;
|-&lt;br /&gt;
| a glass of iced raspberry tea || Weight: &amp;lt;1 pound || || [[Strength of Will]]&amp;lt;br&amp;gt;10 quaffs || 500&lt;br /&gt;
|-&lt;br /&gt;
| a frosted peach shake || Weight: &amp;lt;1 pound || || [[Strength]]&amp;lt;br&amp;gt;10 quaffs || 150&lt;br /&gt;
|-&lt;br /&gt;
| tall cold glass of lemonade || Weight: &amp;lt;1 pound || || [[Mobility]]&amp;lt;br&amp;gt;10 quaffs || 300&lt;br /&gt;
|-&lt;br /&gt;
| a painted clay mug of cold chocolate milk || Weight: &amp;lt;1 pound || || [[Elemental Defense III]]&amp;lt;br&amp;gt;10 quaffs || 200&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Get_Thee_Behind_Me&amp;diff=144629</id>
		<title>BVShop:Get Thee Behind Me</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Get_Thee_Behind_Me&amp;diff=144629"/>
		<updated>2021-02-13T19:20:33Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: changed current to 2021Q1&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Get Thee Behind Me&lt;br /&gt;
|look=a soot-darkened fel wagon&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 5], Lich# 26897, go wagon&lt;br /&gt;
|fest=dr|year=2021|letter=G}}&lt;br /&gt;
===Get Thee Behind Me, Entrance===&amp;lt;!--==={{{ [Get Thee Behind Me]  2021-02-13 14:18:40 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Get Thee Behind Me - &lt;br /&gt;
|desc=Windows line the walls of the wagon, though each is rendered useless by a heavy layer of soot in addition to the shield rack that blocks an entire row itself.  On a small counter beneath one of the windows is a steel-framed note and a dingy oil lamp, and a tattered ivory vellum sign lined with faded script is hooked carelessly over one of the rack&#039;s supports.&lt;br /&gt;
|exits= east, out}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;tattered ivory vellum sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The kidney shield, targe, and buckler will hold a weapon up to 4 pounds.  The heater, parma, and lantern shield will hold a weapon up to 8 pounds.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the small counter you see:||contents= a pale grey parchment certificate.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a pale grey parchment certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apalegreyparchmentcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apalegreyparchmentcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your certificate will unlock a pocketed shield from Tier 1 to Tier 2.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the grey parchment certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This certificate will unlock your shield to tier 2.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the shield rack you see:||contents= a copper-studded verdant mossbark kidney shield, a bronze sigil-branded eahnor targe, a reinforced cross-banded mithril buckler, a gold crown-edged rolaren heater, an ebony bolt-engraved dark mithglin parma and a radially bladed silvery ora lantern shield.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a copper-studded verdant mossbark kidney shield || Weight: 6 pounds &amp;lt;br&amp;gt;Enchant: +20|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acopper-studdedverdantmossbarkkidneyshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acopper-studdedverdantmossbarkkidneyshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of green suede straps and oval copper buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a bronze sigil-branded eahnor targe || Weight: 5 pounds &amp;lt;br&amp;gt;Enchant: +18|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abronzesigil-brandedeahnortarge&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abronzesigil-brandedeahnortarge&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the targe can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This targe is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the targe&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the targe, a complex webbing of crimson suede straps and round bronze buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a reinforced cross-banded mithril buckler || Weight: 5 pounds &amp;lt;br&amp;gt;Enchant: +20|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-areinforcedcross-bandedmithrilbuckler&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-areinforcedcross-bandedmithrilbuckler&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the buckler can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This buckler is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the buckler&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the buckler, a complex webbing of grey leather straps and sturdy square buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a gold crown-edged rolaren heater || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agoldcrown-edgedrolarenheater&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agoldcrown-edgedrolarenheater&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the heater can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This heater is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the heater&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the heater, a complex webbing of gold suede straps and square gold buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| an ebony bolt-engraved dark mithglin parma || Weight: 7 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anebonybolt-engraveddarkmithglinparma&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebonybolt-engraveddarkmithglinparma&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the parma can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This parma is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the parma&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the parma, a complex webbing of black suede straps and heavy square buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a radially bladed silvery ora lantern shield || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aradiallybladedsilveryoralanternshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aradiallybladedsilveryoralanternshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of white suede straps and round silver buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Get Thee Behind Me&lt;br /&gt;
|look=a soot-darkened fel wagon&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 5], Lich# &amp;lt;room # outside shop&amp;gt;, go east&lt;br /&gt;
|fest=dr|year=2021|letter=G}}&lt;br /&gt;
===Get Thee Behind Me, East===&amp;lt;!--==={{{ [Get Thee Behind Me]  2021-02-13 14:21:34 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Get Thee Behind Me - &lt;br /&gt;
|desc=Sparce slivers of light peek in through clear streaks on the sooty windows by virtue of a cleaning job only half-done, and a wall-length shield rack occupies the rear of the wagon.  A tattered ivory vellum sign lined with faded script dangles from a broken peg on the side of the rack.&lt;br /&gt;
|exits= west}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;tattered ivory vellum sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The greatshield, wall shield, and pavis can all hold weapons up to 12 pounds.  The aegis, scutum, and kite shield can hold a weapon up to 10 pounds.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the wall-length shield rack you see:||contents= a scarlet flame-edged golden vaalorn greatshield, a silver wing-etched grey ora wall shield, a knotwork-edged mottled green imflass pavis, a bronze hydra-embossed eahnor aegis, a stud-edged onyx rolaren scutum and a cerulean griffin-crested mithglin kite shield.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a scarlet flame-edged golden vaalorn greatshield || Weight: 11 pounds &amp;lt;br&amp;gt;Enchant: +18|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ascarletflame-edgedgoldenvaalorngreatshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ascarletflame-edgedgoldenvaalorngreatshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the greatshield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This greatshield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the greatshield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the greatshield, a complex webbing of scarlet leather straps and heavy invar buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a silver wing-etched grey ora wall shield || Weight: 12 pounds &amp;lt;br&amp;gt;Enchant: +20|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilverwing-etchedgreyorawallshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilverwing-etchedgreyorawallshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of pale grey suede straps and silver oval buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a knotwork-edged mottled green imflass pavis || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +17|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aknotwork-edgedmottledgreenimflasspavis&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aknotwork-edgedmottledgreenimflasspavis&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the pavis can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This pavis is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the pavis&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the pavis, a complex webbing of green suede straps and square faenor buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a bronze hydra-embossed eahnor aegis || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +18|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abronzehydra-embossedeahnoraegis&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abronzehydra-embossedeahnoraegis&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the aegis can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This aegis is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the aegis&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the aegis, a complex webbing of crimson suede straps and round bronze buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a stud-edged onyx rolaren scutum || Weight: 10 pounds &amp;lt;br&amp;gt;Enchant: +20|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-astud-edgedonyxrolarenscutum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-astud-edgedonyxrolarenscutum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the scutum can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This scutum is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the scutum&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the scutum, a complex webbing of ebony leather straps and heavy black buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a cerulean griffin-crested mithglin kite shield || Weight: 9 pounds &amp;lt;br&amp;gt;Enchant: +20|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aceruleangriffin-crestedmithglinkiteshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aceruleangriffin-crestedmithglinkiteshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of cerulean suede straps and square silver buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:The_Cover_Up&amp;diff=144627</id>
		<title>BVShop:The Cover Up</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:The_Cover_Up&amp;diff=144627"/>
		<updated>2021-02-13T19:19:06Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: changed current to 2021Q1&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=a narrow building at the end of the wall&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=Map Room 3, Lich# 26857, go narrow building&lt;br /&gt;
|fest=dr|year=2021|letter=C}}&lt;br /&gt;
===The Cover Up, Men&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Men&#039;s Room] 23751 2021-02-13 01:56:59 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Men&#039;s Room - 23751&lt;br /&gt;
|desc=Dark and reflective, the surrounding walls are covered in smooth ebony planks that have been secured with silver-headed nails.  A marble-topped iron stand with a small crystal bowl flanks one side of the entrance, and a pair of well-dressed mannequins have been situated in front of a tri-mirrored wall, giving the illusion of a much larger collection of display models.  Sheer black lace hangs over a doorway leading to the back of the shop.&lt;br /&gt;
|exits= out}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the iron stand you see:||contents=&amp;lt;br&amp;gt;&amp;lt;b&amp;gt;Containers [1]:&amp;lt;/b&amp;gt; a crystal bowl}}&lt;br /&gt;
{{Container2||container=In the bowl you see:||contents= some star-shaped mint chocolate.}}&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
{{Container2||container=On the short male mannequin you see:||contents= a faded ebon leather vestment beaded in pale bone, a layered shroud of well-brushed wolf pelts, a dark leather duster branded in skeletal designs, a heavy ashen suede robe hung in various bone fetishes, a charcoal felted wool overcoat with long buckskin lapels, a shaggy bear fur coat covered in a myriad of buckles and a leaf-branded pale leather cloak shaded in gradient inks.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a faded ebon leather vestment beaded in pale bone || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afadedebonleathervestmentbeadedinpalebone&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afadedebonleathervestmentbeadedinpalebone&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this vestment is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This vestment is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your vestment is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered shroud of well-brushed wolf pelts || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alayeredshroudofwell-brushedwolfpelts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alayeredshroudofwell-brushedwolfpelts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a dark leather duster branded in skeletal designs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adarkleatherdusterbrandedinskeletaldesigns&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adarkleatherdusterbrandedinskeletaldesigns&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a heavy ashen suede robe hung in various bone fetishes || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavyashensuederobehunginvariousbonefetishes&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavyashensuederobehunginvariousbonefetishes&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a charcoal felted wool overcoat with long buckskin lapels || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acharcoalfeltedwoolovercoatwithlongbuckskinlapels&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acharcoalfeltedwoolovercoatwithlongbuckskinlapels&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a shaggy bear fur coat covered in a myriad of buckles || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashaggybearfurcoatcoveredinamyriadofbuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashaggybearfurcoatcoveredinamyriadofbuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a leaf-branded pale leather cloak shaded in gradient inks || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aleaf-brandedpaleleathercloakshadedingradientinks&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aleaf-brandedpaleleathercloakshadedingradientinks&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,100&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the tall male mannequin you see:||contents= a muted sepia tweed overcoat with umber leather pockets, a blackened grey nubuck longcoat hooked down each sleeve, a sigil-stitched raw linen gaberdine trimmed in thick suede, a rough leather-scaled robe dyed a matte jet black, a fitted navy blue leather coat with an iron-braced sleeve, a buckskin greatcloak caught with a thin copper pauldron and a snowy white silk longcloak mantled in tonal furs.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a muted sepia tweed overcoat with umber leather pockets || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amutedsepiatweedovercoatwithumberleatherpockets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amutedsepiatweedovercoatwithumberleatherpockets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a blackened grey nubuck longcoat hooked down each sleeve || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablackenedgreynubucklongcoathookeddowneachsleeve&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablackenedgreynubucklongcoathookeddowneachsleeve&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sigil-stitched raw linen gaberdine trimmed in thick suede || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asigil-stitchedrawlinengaberdinetrimmedinthicksuede&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asigil-stitchedrawlinengaberdinetrimmedinthicksuede&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this gaberdine is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This gaberdine is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your gaberdine is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rough leather-scaled robe dyed a matte jet black || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aroughleather-scaledrobedyedamattejetblack&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aroughleather-scaledrobedyedamattejetblack&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fitted navy blue leather coat with an iron-braced sleeve || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afittednavyblueleathercoatwithaniron-bracedsleeve&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afittednavyblueleathercoatwithaniron-bracedsleeve&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a buckskin greatcloak caught with a thin copper pauldron || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abuckskingreatcloakcaughtwithathincopperpauldron&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abuckskingreatcloakcaughtwithathincopperpauldron&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this greatcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This greatcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your greatcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a snowy white silk longcloak mantled in tonal furs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asnowywhitesilklongcloakmantledintonalfurs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asnowywhitesilklongcloakmantledintonalfurs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=a narrow building at the end of the wall&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=Map Room 3, go doorway&lt;br /&gt;
|fest=dr|year=2021|letter=C}}&lt;br /&gt;
===The Cover Up, Women&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Women&#039;s Room] 23752 2021-02-13 09:56:12 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Women&#039;s Room - 23752&lt;br /&gt;
|desc=The back of the shop has been decorated marginally more than the front room but still lacks flashy or ornate enhancements.  Delicate, candle-filled sconces provide the majority of lighting, while a recessed, double-paned window allows the sunlight to bathe the mannequins in warm, natural glow.  A doorway leads back into the men&#039;s section of the shop.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
{{Container2||container=On the tall female mannequin you see:||contents= a caramel mink cloak lined in flora-embroidered velvet, a silk-backed tatted ecru lace overcoat, a nacre-beaded dark sapphire suede longcoat, a lace-cut obsidian velvet duster lined in tonal leather, a flora-sewn iridescent lilac satin robe, a split-back greyish taupe tweed longcoat and an oiled ivory leather robe spilling layers of pale lace.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a caramel mink cloak lined in flora-embroidered velvet || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acaramelminkcloaklinedinflora-embroideredvelvet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acaramelminkcloaklinedinflora-embroideredvelvet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a silk-backed tatted ecru lace overcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilk-backedtattedecrulaceovercoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilk-backedtattedecrulaceovercoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a nacre-beaded dark sapphire suede longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anacre-beadeddarksapphiresuedelongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anacre-beadeddarksapphiresuedelongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lace-cut obsidian velvet duster lined in tonal leather || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alace-cutobsidianvelvetdusterlinedintonalleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alace-cutobsidianvelvetdusterlinedintonalleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flora-sewn iridescent lilac satin robe || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aflora-sewniridescentlilacsatinrobe&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflora-sewniridescentlilacsatinrobe&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-back greyish taupe tweed longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asplit-backgreyishtaupetweedlongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asplit-backgreyishtaupetweedlongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| an oiled ivory leather robe spilling layers of pale lace || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anoiledivoryleatherrobespillinglayersofpalelace&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anoiledivoryleatherrobespillinglayersofpalelace&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the petite female mannequin you see:||contents= a chain-draped gilded wine lace shroud, a sage-colored wild silk robe banded in linden rings, a brushed amethyst wool longcoat with a high ivory tulle collar, a cognac nubuck leather coat blackened down the shoulders, a thorn-branded garnet leather duster, a rose gold raw silk cloak draped with soft furs and a fur-collared copper and turquoise tartan longcoat.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a chain-draped gilded wine lace shroud || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-achain-drapedgildedwinelaceshroud&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-achain-drapedgildedwinelaceshroud&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sage-colored wild silk robe banded in linden rings || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asage-coloredwildsilkrobebandedinlindenrings&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asage-coloredwildsilkrobebandedinlindenrings&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a brushed amethyst wool longcoat with a high ivory tulle collar || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abrushedamethystwoollongcoatwithahighivorytullecollar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abrushedamethystwoollongcoatwithahighivorytullecollar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cognac nubuck leather coat blackened down the shoulders || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acognacnubuckleathercoatblackeneddowntheshoulders&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acognacnubuckleathercoatblackeneddowntheshoulders&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a thorn-branded garnet leather duster || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athorn-brandedgarnetleatherduster&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athorn-brandedgarnetleatherduster&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You notice a skeletal dark alabaster clasp secured at the top of the garnet leather duster.&amp;lt;br&amp;gt;&lt;br /&gt;
a thorn-branded garnet leather duster&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rose gold raw silk cloak draped with soft furs || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-arosegoldrawsilkcloakdrapedwithsoftfurs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-arosegoldrawsilkcloakdrapedwithsoftfurs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,100&lt;br /&gt;
|-&lt;br /&gt;
| a fur-collared copper and turquoise tartan longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afur-collaredcopperandturquoisetartanlongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afur-collaredcopperandturquoisetartanlongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==2020Q3==&lt;br /&gt;
&amp;lt;section begin=2020Q3 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=a narrow building&lt;br /&gt;
|location=[Map Room #3], Lich #26857, go narrow building&lt;br /&gt;
|fest=dr|year=2020|letter=C}}&lt;br /&gt;
===The Cover Up, Men&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Men&#039;s Room] 23751 2020-08-15 17:48:40 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Men&#039;s Room - 23751&lt;br /&gt;
|desc=Dark and reflective, the surrounding walls are covered in smooth ebony planks that have been secured with silver-headed nails.  A marble-topped iron stand with a small crystal bowl flanks one side of the entrance, and a pair of well-dressed mannequins have been situated in front of a tri-mirrored wall, giving the illusion of a much larger collection of display models.  Sheer black lace hangs over a doorway leading to the back of the shop.&lt;br /&gt;
|exits= out}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the iron stand you see:||contents=&amp;lt;br&amp;gt;&amp;lt;b&amp;gt;Containers [1]:&amp;lt;/b&amp;gt; a crystal bowl}}&lt;br /&gt;
{{Container2||container=In the bowl you see:||contents= some star-shaped mint chocolate.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| mint chocolate || || ||  || free&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
{{Container2||container=On the tall male mannequin you see:||contents= a flat-collared charcoal tweed overcoat with suede pockets, a muted green nubuck longcoat patched in umber suede, a grey-beige woven linen gaberdine with brass riveting, a matte burgundy leather robe branded with thin veining, a long onyx leather coat mantled in thick raven feathers, a fringed tan buckskin greatcloak reinforced by iron rings and a stone-colored textured silk longcloak with thick cuffs.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a flat-collared charcoal tweed overcoat with suede pockets || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aflat-collaredcharcoaltweedovercoatwithsuedepockets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflat-collaredcharcoaltweedovercoatwithsuedepockets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a muted green nubuck longcoat patched in umber suede || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amutedgreennubucklongcoatpatchedinumbersuede&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amutedgreennubucklongcoatpatchedinumbersuede&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a grey-beige woven linen gaberdine with brass riveting || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agrey-beigewovenlinengaberdinewithbrassriveting&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agrey-beigewovenlinengaberdinewithbrassriveting&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this gaberdine is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This gaberdine is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your gaberdine is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a matte burgundy leather robe branded with thin veining || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amatteburgundyleatherrobebrandedwiththinveining&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amatteburgundyleatherrobebrandedwiththinveining&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a long onyx leather coat mantled in thick raven feathers || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alongonyxleathercoatmantledinthickravenfeathers&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alongonyxleathercoatmantledinthickravenfeathers&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fringed tan buckskin greatcloak reinforced by iron rings || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afringedtanbuckskingreatcloakreinforcedbyironrings&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afringedtanbuckskingreatcloakreinforcedbyironrings&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this greatcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This greatcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your greatcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a stone-colored textured silk longcloak with thick cuffs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-astone-coloredtexturedsilklongcloakwiththickcuffs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-astone-coloredtexturedsilklongcloakwiththickcuffs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the short male mannequin you see:||contents= a black satin vestment with gold-threaded symbol arabesques, an asymmetric dark fustian shroud caught by knotted leather, a thin-buckled ivory leather duster cross-strapped in suede, a velvet-trimmed emerald suede robe with a heavy mesh hood, a flare-hemmed auburn suede overcoat with satin embroidery, a buttoned navy twill coat with a flared leather collar and a brushed grey wolf fur cloak layered with dark bear pelts.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a black satin vestment with gold-threaded symbol arabesques || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablacksatinvestmentwithgold-threadedsymbolarabesques&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablacksatinvestmentwithgold-threadedsymbolarabesques&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this vestment is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This vestment is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your vestment is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| an asymmetric dark fustian shroud caught by knotted leather || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anasymmetricdarkfustianshroudcaughtbyknottedleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anasymmetricdarkfustianshroudcaughtbyknottedleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a thin-buckled ivory leather duster cross-strapped in suede || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athin-buckledivoryleatherdustercross-strappedinsuede&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athin-buckledivoryleatherdustercross-strappedinsuede&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a velvet-trimmed emerald suede robe with a heavy mesh hood || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avelvet-trimmedemeraldsuederobewithaheavymeshhood&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avelvet-trimmedemeraldsuederobewithaheavymeshhood&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flare-hemmed auburn suede overcoat with satin embroidery || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aflare-hemmedauburnsuedeovercoatwithsatinembroidery&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflare-hemmedauburnsuedeovercoatwithsatinembroidery&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a buttoned navy twill coat with a flared leather collar || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abuttonednavytwillcoatwithaflaredleathercollar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abuttonednavytwillcoatwithaflaredleathercollar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a brushed grey wolf fur cloak layered with dark bear pelts || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abrushedgreywolffurcloaklayeredwithdarkbearpelts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abrushedgreywolffurcloaklayeredwithdarkbearpelts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1100&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room #], Lich# 23751, go doorway&lt;br /&gt;
|fest=dr|year=2020|letter=C}}&lt;br /&gt;
===The Cover Up, Women&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Women&#039;s Room] 23752 2020-08-15 17:49:33 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Women&#039;s Room - 23752&lt;br /&gt;
|desc=The back of the shop has been decorated marginally more than the front room but still lacks any flashy or ornate enhancements.  Delicate, candle-filled sconces provide the majority of lighting, while a recessed, double-paned window allows the moonlight to bathe the mannequins in warm, natural glow.  A doorway leads back into the men&#039;s section of the shop.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
{{Container2||container=On the tall female mannequin you see:||contents= a chain-draped red jacquard cloak beaded in onyx teardrops, a leather-skirted iridescent silk overcoat, a smoky emerald suede longcoat with onyx lace cuffs, a plum velvet duster with rings pierced down each sleeve, a layered robe of overlapping autumnal-dyed satin leaves, a cobalt velvet longcoat with crescent-strung chains and a grey-dipped ecru lace robe caught with black silk ribbons.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a chain-draped red jacquard cloak beaded in onyx teardrops || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-achain-drapedredjacquardcloakbeadedinonyxteardrops&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-achain-drapedredjacquardcloakbeadedinonyxteardrops&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a leather-skirted iridescent silk overcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aleather-skirtediridescentsilkovercoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aleather-skirtediridescentsilkovercoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a smoky emerald suede longcoat with onyx lace cuffs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmokyemeraldsuedelongcoatwithonyxlacecuffs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmokyemeraldsuedelongcoatwithonyxlacecuffs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a plum velvet duster with rings pierced down each sleeve || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aplumvelvetdusterwithringspierceddowneachsleeve&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aplumvelvetdusterwithringspierceddowneachsleeve&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered robe of overlapping autumnal-dyed satin leaves || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alayeredrobeofoverlappingautumnal-dyedsatinleaves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alayeredrobeofoverlappingautumnal-dyedsatinleaves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cobalt velvet longcoat with crescent-strung chains || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acobaltvelvetlongcoatwithcrescent-strungchains&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acobaltvelvetlongcoatwithcrescent-strungchains&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a grey-dipped ecru lace robe caught with black silk ribbons || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agrey-dippedecrulacerobecaughtwithblacksilkribbons&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agrey-dippedecrulacerobecaughtwithblacksilkribbons&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the petite female mannequin you see:||contents= a nacreous black lace shroud lined in burnt burgundy velvet, a lattice-woven pale chainsil robe, a tall-collared ink blue brocade longcoat, a fitted saffron suede coat with a jet-beaded velvet collar, a well-oiled black leather duster slit high down each side, a long raw silk cloak dyed in a gradient of jewel tones and a metallic emerald and gold plumille longcoat.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a nacreous black lace shroud lined in burnt burgundy velvet || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anacreousblacklaceshroudlinedinburntburgundyvelvet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anacreousblacklaceshroudlinedinburntburgundyvelvet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lattice-woven pale chainsil robe || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alattice-wovenpalechainsilrobe&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alattice-wovenpalechainsilrobe&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a tall-collared ink blue brocade longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-atall-collaredinkbluebrocadelongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-atall-collaredinkbluebrocadelongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fitted saffron suede coat with a jet-beaded velvet collar || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afittedsaffronsuedecoatwithajet-beadedvelvetcollar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afittedsaffronsuedecoatwithajet-beadedvelvetcollar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a well-oiled black leather duster slit high down each side || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awell-oiledblackleatherdusterslithighdowneachside&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awell-oiledblackleatherdusterslithighdowneachside&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a long raw silk cloak dyed in a gradient of jewel tones || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alongrawsilkcloakdyedinagradientofjeweltones&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alongrawsilkcloakdyedinagradientofjeweltones&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a metallic emerald and gold plumille longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ametallicemeraldandgoldplumillelongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ametallicemeraldandgoldplumillelongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2020Q3 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Previous Inventory==&lt;br /&gt;
&amp;lt;section begin=current /&amp;gt;&amp;lt;includeonly&amp;gt;&lt;br /&gt;
==The Cover Up== &amp;lt;/includeonly&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Opened&#039;&#039;&#039;: Unknown; &#039;&#039;&#039;Inventory Updates&#039;&#039;&#039;: August 2019; &#039;&#039;&#039;Verified:&#039;&#039;&#039; 08/14/2019, 2/13/2020&lt;br /&gt;
&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up, Men&#039;s Room&lt;br /&gt;
|look=a narrow building&lt;br /&gt;
|location=[Map Room #3], Lich #26857, go building}}&lt;br /&gt;
===Men&#039;s Room===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Men&#039;s Room&lt;br /&gt;
|desc=Dark and reflective, the surrounding walls are covered in smooth ebony planks that have been secured with silver-headed nails.  A marble-topped iron stand with a small crystal bowl flanks one side of the entrance, and a pair of well-dressed mannequins have been situated in front of a tri-mirrored wall, giving the illusion of a much larger collection of display models.  Sheer black lace hangs over a doorway leading to the back of the shop.  You also see a tall male mannequin with some stuff on it and a short male mannequin with some stuff on it.&lt;br /&gt;
|exits = out}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the crystal bowl you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
|some star-shaped mint chocolate&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a long onyx fur cloak draped with narrow chains on the shoulders || Weight: 6 pounds&amp;lt;br&amp;gt;Pocketed: &amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-alongonyxfurcloakdrapedwithnarrowchainsontheshoulders&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alongonyxfurcloakdrapedwithnarrowchainsontheshoulders&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;You can tell that the cloak is as light as it can get and that its pockets could not possibly get any deeper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a wide-lapeled plum leather longcoat with grey silk lining || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-awide-lapeledplumleatherlongcoatwithgreysilklining&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awide-lapeledplumleatherlongcoatwithgreysilklining&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flare-hemmed auburn suede overcoat with russet satin embroidery || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aflare-hemmedauburnsuedeovercoatwithrussetsatinembroidery&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflare-hemmedauburnsuedeovercoatwithrussetsatinembroidery&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered malachite-hued robe with copper detailing || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-alayeredmalachite-huedrobewithcopperdetailing&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alayeredmalachite-huedrobewithcopperdetailing&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rustic bazan duster with a tall oak-beaded collar || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-arusticbazandusterwithatalloak-beadedcollar&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-arusticbazandusterwithatalloak-beadedcollar&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an ebon-sheened indigo fustian shroud with pewter threading || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-anebon-sheenedindigofustianshroudwithpewterthreading&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebon-sheenedindigofustianshroudwithpewterthreading&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a heavily embroidered gold satin vestment edged in emerald || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavilyembroideredgoldsatinvestmentedgedinemerald&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavilyembroideredgoldsatinvestmentedgedinemerald&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this vestment is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This vestment is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your vestment is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a flannel-lined sisken overcoat with bronze whipstitching || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aflannel-linedsiskenovercoatwithbronzewhipstitching&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflannel-linedsiskenovercoatwithbronzewhipstitching&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jet black kidskin longcoat with braid-detailed lapels || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ajetblackkidskinlongcoatwithbraid-detailedlapels&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ajetblackkidskinlongcoatwithbraid-detailedlapels&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a charcoal leather gaberdine edged with metallic silver webbing || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-acharcoalleathergaberdineedgedwithmetallicsilverwebbing&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acharcoalleathergaberdineedgedwithmetallicsilverwebbing&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this gaberdine is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This gaberdine is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your gaberdine is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a slashed wine-hued suede robe with obsidian marbrinus underlay || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aslashedwine-huedsuederobewithobsidianmarbrinusunderlay&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aslashedwine-huedsuederobewithobsidianmarbrinusunderlay&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a glaes-studded raven leather coat with flared sleeve cuffs || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aglaes-studdedravenleathercoatwithflaredsleevecuffs&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aglaes-studdedravenleathercoatwithflaredsleevecuffs&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-hemmed buckskin greatcloak with a puma fur mantle || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-asplit-hemmedbuckskingreatcloakwithapumafurmantle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asplit-hemmedbuckskingreatcloakwithapumafurmantle&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this greatcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This greatcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your greatcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a scarlet lyraigne longcloak with a deep flame-cut hemline || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ascarletlyraignelongcloakwithadeepflame-cuthemline&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ascarletlyraignelongcloakwithadeepflame-cuthemline&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Women&#039;s Room===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Women&#039;s Room&lt;br /&gt;
|desc=The back of the shop has been decorated marginally more than the front room but still lacks any flashy or ornate enhancements.  Delicate, candle-filled sconces provide the majority of lighting, while a recessed, double-paned window allows the moonlight to bathe the mannequins in warm, natural glow.  A doorway leads back into the men&#039;s section of the shop.  You also see a petite female mannequin with some stuff on it and a tall female mannequin with some stuff on it.&lt;br /&gt;
|exits = none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a bone white sindon shroud shot through with pewter threading || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-abonewhitesindonshroudshotthroughwithpewterthreading&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abonewhitesindonshroudshotthroughwithpewterthreading&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a bell-sleeved ashen byssine robe with subtle fretwork details || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-abell-sleevedashenbyssinerobewithsubtlefretworkdetails&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abell-sleevedashenbyssinerobewithsubtlefretworkdetails&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jet-on-silver brocade longcoat with a wedge back vent || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ajet-on-silverbrocadelongcoatwithawedgebackvent&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ajet-on-silverbrocadelongcoatwithawedgebackvent&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a burgundy suede coat with feathery bronze embroidery || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aburgundysuedecoatwithfeatherybronzeembroidery&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aburgundysuedecoatwithfeatherybronzeembroidery&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a satin-lined cobalt sarcenet duster with darts at the waist || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-asatin-linedcobaltsarcenetdusterwithdartsatthewaist&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asatin-linedcobaltsarcenetdusterwithdartsatthewaist&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a dusty amethyst ridgeweaver silk cloak with indigo pearl beading || Weight: 6 pounds&amp;lt;br&amp;gt;Pocketed: &amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-adustyamethystridgeweaversilkcloakwithindigopearlbeading&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adustyamethystridgeweaversilkcloakwithindigopearlbeading&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;You can tell that the cloak is as light as it can get and that its pockets could not possibly get any deeper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a silver-chased violet plumille longcoat with satin lapels || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-asilver-chasedvioletplumillelongcoatwithsatinlapels&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilver-chasedvioletplumillelongcoatwithsatinlapels&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a shoulder-slung cerulean damask cloak with argent satin lining || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ashoulder-slungceruleandamaskcloakwithargentsatinlining&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashoulder-slungceruleandamaskcloakwithargentsatinlining&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your cloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a goldenrod charmeuse overcoat with abstract garnet embroidery || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-agoldenrodcharmeuseovercoatwithabstractgarnetembroidery&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agoldenrodcharmeuseovercoatwithabstractgarnetembroidery&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an austere onyx suede longcoat fettered with leather straps || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-anaustereonyxsuedelongcoatfetteredwithleatherstraps&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anaustereonyxsuedelongcoatfetteredwithleatherstraps&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jewel-toned bourde duster with gold zig-zag stitching || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ajewel-tonedbourdedusterwithgoldzig-zagstitching&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ajewel-tonedbourdedusterwithgoldzig-zagstitching&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lengthy aquamarine marbrinus robe with a sharkbite hem || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-alengthyaquamarinemarbrinusrobewithasharkbitehem&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alengthyaquamarinemarbrinusrobewithasharkbitehem&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cerulean velvet longcloak embossed with stars || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aceruleanvelvetlongcloakembossedwithstars&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aceruleanvelvetlongcloakembossedwithstars&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an alabaster tatted lace robe with a roseate silk underlay || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-analabastertattedlacerobewitharoseatesilkunderlay&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-analabastertattedlacerobewitharoseatesilkunderlay&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&amp;lt;section end=current /&amp;gt;&lt;br /&gt;
==Archived Inventory==&lt;br /&gt;
&amp;lt;section begin=archive /&amp;gt;&amp;lt;includeonly&amp;gt;&lt;br /&gt;
==The Cover Up==&amp;lt;/includeonly&amp;gt;&lt;br /&gt;
===Retired August 2019===&lt;br /&gt;
====Men&#039;s Room====&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the crystal bowl you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
|some star-shaped mint chocolate&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a suede-harnessed black wool robe|| Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=7 | T0 [[Whisper cloak | Whisper Cloaks]]|| 75&lt;br /&gt;
|-&lt;br /&gt;
| some bronze-sheened green viper skin robes|| Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a shoulder-strapped obsidian leather coat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a gilt-traced crimson leather longcloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cobalt suede cassock stitched with silvered thread || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a weathered cordovan leather longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a heavy whiskey brown twill overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a high-collared ashen wool cloak edged with kelyn rivets || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional || T2 [[Whisper cloak | Whisper Cloak]] || 1100&lt;br /&gt;
|-&lt;br /&gt;
| a navy leather overcoat mantled in dark oilskin || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=6 | T0 [[Whisper cloak | Whisper Cloaks]] || 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-tailed olive suede coat cuffed in tonal leather || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sanguine-dyed wool robe with long blackened sleeves || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a bark-colored kidskin cloak caught in graduated layers || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a pristine white silk cassock with a stiff leather collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flare-collared smoky charcoal tweed longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a pale cream-colored flyrsilk cloak with pendant sleeves || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| T2 [[Whisper cloak]]|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a garnet-dyed velvet coat with a scalloped lacework collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=6 | T0 [[Whisper cloak | Whisper Cloaks]] || 75&lt;br /&gt;
|-&lt;br /&gt;
| an oiled onyx snakeskin robe with a faint green sheen || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a silk-lined cloak of long ivory swan feathers || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a short-collared dark lavender brocade pelisse || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| some green-black velvet robes with textured leather sleeves || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered heather grey wool longcloak embroidered in ivory || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a pale vanilla rose-cut lace coat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=7 | T0 [[Whisper cloak | Whisper Cloaks]]|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a leaf-patterned emerald flyrsilk longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an asymmetrically draped smoke grey suede cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a pastel aquamarine paisley silk pelisse || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jade-on-onyx brocade coat trimmed in dark mink || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an ermine-edged niveous nubuck leather overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a chele-trimmed muted citrine silk longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===February 2018 Items===&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
====Men’s Room====&lt;br /&gt;
&#039;&#039;&#039;Opened&#039;&#039;&#039;: Unknown; &#039;&#039;&#039;Inventory Updates&#039;&#039;&#039;: February 2018; &#039;&#039;&#039;Verified:&#039;&#039;&#039; 2/24/18, 6/16/18&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a distressed grey burlap cassock || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=7 | [[Whisper cloak | Whisper Cloaks]] || 75&lt;br /&gt;
|-&lt;br /&gt;
| a stained ink black leather cassock || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a formal ebony longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a velvet-lined russet robe || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a voluminous ebon silk longcloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an elaborate obsidian cape with detailed viridian stitching || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a thick midnight blue fur cloak || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| an elegant grey cloak with delicate lacework along the hems || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a stately black cape with a stiff collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a multi-pocketed dark kidskin overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rune-covered blood red wool cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-tailed longcoat adorned with crow feathers || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a deeply cowled black linen greatcloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a caramel-hued longcoat with understated auburn accents || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{{big|&#039;&#039;&#039;[[Whisper cloak]]s}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a deeply cowled obsidian cloak lined with umber silk || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flowing sealskin coat adorned with glossy black beads || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| some embroidered flyrsilk robes || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a formal grey floor-length flyrsilk cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a delicate emerald silk longcloak embroidered with crimson sigils || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a deep grey and green silk cloak || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a two-toned emerald and ebony velvet cape lined with ruby silk || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a regal pitch black cloak interwoven with teardrop sapphires || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lavish black puma fur overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sleek black leather longcoat with a stiff high collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a blood red robe with midnight black trim || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a dark-toned sapphire flyrsilk cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a frilly grey overcoat with lacy emerald trim || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rich ebony velvet cape with bright white embroidered trim || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===2015 Items===&lt;br /&gt;
&#039;&#039;Room 3: a narrow building&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;[[Whisper cloak]]s&lt;br /&gt;
====Men&#039;s Room====&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the short male mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|some flowing grey and silver marbrinus robes&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a double-breasted dark leather longcoat&lt;br /&gt;
|750&lt;br /&gt;
|unlocked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a hooded ebon-hued velvet robe&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a tailored longcoat lined with dark silk&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a dual-toned grey bourde cassock edged with silver piping&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the tall male mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|a long midnight blue greatcloak&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a tenebrous black cloak lined with smooth satin&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a black linen overcoat with wide-cuffed sleeves&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the petite female mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|a billowing sanguine cape adorned with fiery jacinth beading&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a flowing black silk cloak dappled with red dreamstones&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a black velvet cape lined with rich burgundy silk&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a sable lambswool cloak trimmed with ebon-tipped fox tails&lt;br /&gt;
|750&lt;br /&gt;
|unlocked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|an ankle-length deep russet coat with a fitted waist.&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the tall female mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|some elegant grey-on-black chainsil robes&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a dark silk mantle with a wool capelet&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a cowled midnight-hued cloak with a subtle blued sheen&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a coal black velvet pelisse&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
===2/24/18 Update===&lt;br /&gt;
&lt;br /&gt;
====Men&#039;s Room====&lt;br /&gt;
&#039;&#039;&#039;[[Whisper cloak]]s&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a satin-lined smoke grey paeline cloak || Pocketed:Huge (150 lbs)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a high-collared black wool cape ||rowspan=&amp;quot;6&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;6&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;6&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a deep mocha wool longcoat&lt;br /&gt;
|-&lt;br /&gt;
| some thick black velvet robes &lt;br /&gt;
|-&lt;br /&gt;
| a split-tailed obsidian longcoat &lt;br /&gt;
|-&lt;br /&gt;
| a hooded dark silk robe&lt;br /&gt;
|-&lt;br /&gt;
| a black-on-grey bourde cassock with thick silver piping&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a thick panther fur greatcloak ||rowspan=&amp;quot;6&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;6&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;6&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fur-lined dark chestnut cloak&lt;br /&gt;
|-&lt;br /&gt;
| an iron grey silk cloak &lt;br /&gt;
|-&lt;br /&gt;
| a charcoal-hued overcoat adorned with silver-threaded knotwork&lt;br /&gt;
|-&lt;br /&gt;
| a sigil-covered crimson silk cape &lt;br /&gt;
|-&lt;br /&gt;
| a dark satin overcoat with ebon leather edging&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&#039;&#039;&#039;[[Whisper cloak]]s&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
|-&lt;br /&gt;
| a crimson silk longcloak with gold-on-red jacquard edging || Pocketed:Huge (150 lbs)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a black velvet cape lined with deep plum silk ||rowspan=&amp;quot;6&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;6&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;6&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a full black silk cloak with gem-studded serpentine designs &lt;br /&gt;
|-&lt;br /&gt;
| a deep russet coat with a ribbon-cinched waist&lt;br /&gt;
|-&lt;br /&gt;
| a rich burgundy chainsil cloak laced with dark velvet ribbon &lt;br /&gt;
|-&lt;br /&gt;
| a billowy sanguine cape adorned with star sapphire beading &lt;br /&gt;
|-&lt;br /&gt;
| a shadowy obsidian silk cloak trimmed with cormorant feathers &lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a high-collared dark crimson brocade cape ||rowspan=&amp;quot;7&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;7&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;7&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cowled obsidian cloak with a black lace hem &lt;br /&gt;
|-&lt;br /&gt;
| a dark-toned sapphire flyrsilk cloak &lt;br /&gt;
|-&lt;br /&gt;
| some full umber and gold brocade robes &lt;br /&gt;
|-&lt;br /&gt;
| a velvet-lined deep emerald silk cloak &lt;br /&gt;
|-&lt;br /&gt;
| a pewter-threaded dark velvet pelisse&lt;br /&gt;
|-&lt;br /&gt;
| a sleek charcoal velvet cloak with ornamental silver trim &lt;br /&gt;
|-&lt;br /&gt;
|}&amp;lt;section end=archive /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[[Category: Bloodriven Village Shops|T]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144623</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144623"/>
		<updated>2021-02-13T19:12:39Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Get Thee Behind Me|Get Thee Behind Me]]=={{#section:BVShop:Get Thee Behind Me|2021Q1}}&lt;br /&gt;
==[[BVShop:Potation Parlor|Potation Parlor]]=={{#section:BVShop:Potation Parlor|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Potation_Parlor&amp;diff=144621</id>
		<title>BVShop:Potation Parlor</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Potation_Parlor&amp;diff=144621"/>
		<updated>2021-02-13T19:10:54Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: Created page with &amp;quot;==Current Inventory== &amp;lt;section begin=2021Q1 /&amp;gt; {{Festshop |shopname=Potation Parlor |look=a crumbling abandoned building&amp;lt;!--#shop look, the outside: e.g. crumbling two-story s...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==Current Inventory==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Potation Parlor&lt;br /&gt;
|look=a crumbling abandoned building&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 8], Lich# 26888, go abandoned building&lt;br /&gt;
|fest=dr|year=2021|letter=P}}&lt;br /&gt;
===Potation Parlor===&amp;lt;!--==={{{ [Potation Parlor]  2021-02-13 14:29:38 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Potation Parlor - &lt;br /&gt;
|desc=Cradled within the frame of an abandoned building, the shop features a scorched mural born from a past fire and shaped into art.  A dingy counter rests against one wall and several stools are available for seating.  An opening in a crumbling wall offers access to the outside.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the dingy counter you see:||contents= a canister of spiced beef soup, a canister of rich chicken soup, a canister of aromatic turtle soup, a canister of warm vegetable broth, a glass of iced raspberry tea, a frosted peach shake, a tall cold glass of lemonade and a painted clay mug of cold chocolate milk.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a canister of spiced beef soup || Weight: &amp;lt;1 pound || || [[Warding Sphere]]&amp;lt;br&amp;gt;10 quaffs || 500&lt;br /&gt;
|-&lt;br /&gt;
| a canister of rich chicken soup || Weight: &amp;lt;1 pound || || [[Prismatic Guard]]&amp;lt;br&amp;gt;10 quaffs || 250&lt;br /&gt;
|-&lt;br /&gt;
| a canister of aromatic turtle soup || Weight: &amp;lt;1 pound || || [[Heroism]]&amp;lt;br&amp;gt;10 quaffs || 750&lt;br /&gt;
|-&lt;br /&gt;
| a canister of warm vegetable broth || Weight: &amp;lt;1 pound || || [[Prayer of Protection]]&amp;lt;br&amp;gt;10 quaffs || 200&lt;br /&gt;
|-&lt;br /&gt;
| a glass of iced raspberry tea || Weight: &amp;lt;1 pound || || [[Strength of Will]]&amp;lt;br&amp;gt;10 quaffs || 500&lt;br /&gt;
|-&lt;br /&gt;
| a frosted peach shake || Weight: &amp;lt;1 pound || || [[Strength]]&amp;lt;br&amp;gt;10 quaffs || 150&lt;br /&gt;
|-&lt;br /&gt;
| tall cold glass of lemonade || Weight: &amp;lt;1 pound || || [[Mobility]]&amp;lt;br&amp;gt;10 quaffs || 300&lt;br /&gt;
|-&lt;br /&gt;
| a painted clay mug of cold chocolate milk || Weight: &amp;lt;1 pound || || [[Elemental Defense III]]&amp;lt;br&amp;gt;10 quaffs || 200&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144616</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144616"/>
		<updated>2021-02-13T19:03:00Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Get Thee Behind Me|Get Thee Behind Me]]=={{#section:BVShop:Get Thee Behind Me|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Get_Thee_Behind_Me&amp;diff=144615</id>
		<title>BVShop:Get Thee Behind Me</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Get_Thee_Behind_Me&amp;diff=144615"/>
		<updated>2021-02-13T18:59:51Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: Created page with &amp;quot;&amp;lt;!-- begin wiki output --&amp;gt; &amp;lt;!-- Shop:Get_Thee_Behind_Me --&amp;gt; &amp;lt;!--__TOC__--&amp;gt; ==Current Inventory== &amp;lt;section begin=2021Q1 /&amp;gt; {{Festshop |shopname=Get Thee Behind Me |look=a soot-...&amp;quot;&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;!-- begin wiki output --&amp;gt;&lt;br /&gt;
&amp;lt;!-- Shop:Get_Thee_Behind_Me --&amp;gt;&lt;br /&gt;
&amp;lt;!--__TOC__--&amp;gt;&lt;br /&gt;
==Current Inventory==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Get Thee Behind Me&lt;br /&gt;
|look=a soot-darkened fel wagon&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 5], Lich# 26897, go wagon&lt;br /&gt;
|fest=dr|year=2021|letter=G}}&lt;br /&gt;
===Get Thee Behind Me, Entrance===&amp;lt;!--==={{{ [Get Thee Behind Me]  2021-02-13 14:18:40 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Get Thee Behind Me - &lt;br /&gt;
|desc=Windows line the walls of the wagon, though each is rendered useless by a heavy layer of soot in addition to the shield rack that blocks an entire row itself.  On a small counter beneath one of the windows is a steel-framed note and a dingy oil lamp, and a tattered ivory vellum sign lined with faded script is hooked carelessly over one of the rack&#039;s supports.&lt;br /&gt;
|exits= east, out}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;tattered ivory vellum sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The kidney shield, targe, and buckler will hold a weapon up to 4 pounds.  The heater, parma, and lantern shield will hold a weapon up to 8 pounds.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the small counter you see:||contents= a pale grey parchment certificate.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a pale grey parchment certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apalegreyparchmentcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apalegreyparchmentcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your certificate will unlock a pocketed shield from Tier 1 to Tier 2.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the grey parchment certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This certificate will unlock your shield to tier 2.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the shield rack you see:||contents= a copper-studded verdant mossbark kidney shield, a bronze sigil-branded eahnor targe, a reinforced cross-banded mithril buckler, a gold crown-edged rolaren heater, an ebony bolt-engraved dark mithglin parma and a radially bladed silvery ora lantern shield.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a copper-studded verdant mossbark kidney shield || Weight: 6 pounds &amp;lt;br&amp;gt;Enchant: +20|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acopper-studdedverdantmossbarkkidneyshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acopper-studdedverdantmossbarkkidneyshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of green suede straps and oval copper buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a bronze sigil-branded eahnor targe || Weight: 5 pounds &amp;lt;br&amp;gt;Enchant: +18|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abronzesigil-brandedeahnortarge&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abronzesigil-brandedeahnortarge&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the targe can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This targe is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the targe&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the targe, a complex webbing of crimson suede straps and round bronze buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a reinforced cross-banded mithril buckler || Weight: 5 pounds &amp;lt;br&amp;gt;Enchant: +20|| small [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-areinforcedcross-bandedmithrilbuckler&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-areinforcedcross-bandedmithrilbuckler&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the buckler can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This buckler is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the buckler&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the buckler, a complex webbing of grey leather straps and sturdy square buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a gold crown-edged rolaren heater || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agoldcrown-edgedrolarenheater&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agoldcrown-edgedrolarenheater&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the heater can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This heater is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the heater&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the heater, a complex webbing of gold suede straps and square gold buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| an ebony bolt-engraved dark mithglin parma || Weight: 7 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anebonybolt-engraveddarkmithglinparma&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebonybolt-engraveddarkmithglinparma&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the parma can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This parma is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the parma&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the parma, a complex webbing of black suede straps and heavy square buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a radially bladed silvery ora lantern shield || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +20|| medium [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aradiallybladedsilveryoralanternshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aradiallybladedsilveryoralanternshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of white suede straps and round silver buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Get Thee Behind Me&lt;br /&gt;
|look=a soot-darkened fel wagon&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 5], Lich# &amp;lt;room # outside shop&amp;gt;, go east&lt;br /&gt;
|fest=dr|year=2021|letter=G}}&lt;br /&gt;
===Get Thee Behind Me, East===&amp;lt;!--==={{{ [Get Thee Behind Me]  2021-02-13 14:21:34 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Get Thee Behind Me - &lt;br /&gt;
|desc=Sparce slivers of light peek in through clear streaks on the sooty windows by virtue of a cleaning job only half-done, and a wall-length shield rack occupies the rear of the wagon.  A tattered ivory vellum sign lined with faded script dangles from a broken peg on the side of the rack.&lt;br /&gt;
|exits= west}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;tattered ivory vellum sign&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The greatshield, wall shield, and pavis can all hold weapons up to 12 pounds.  The aegis, scutum, and kite shield can hold a weapon up to 10 pounds.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the wall-length shield rack you see:||contents= a scarlet flame-edged golden vaalorn greatshield, a silver wing-etched grey ora wall shield, a knotwork-edged mottled green imflass pavis, a bronze hydra-embossed eahnor aegis, a stud-edged onyx rolaren scutum and a cerulean griffin-crested mithglin kite shield.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a scarlet flame-edged golden vaalorn greatshield || Weight: 11 pounds &amp;lt;br&amp;gt;Enchant: +18|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ascarletflame-edgedgoldenvaalorngreatshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ascarletflame-edgedgoldenvaalorngreatshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the greatshield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This greatshield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the greatshield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the greatshield, a complex webbing of scarlet leather straps and heavy invar buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a silver wing-etched grey ora wall shield || Weight: 12 pounds &amp;lt;br&amp;gt;Enchant: +20|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilverwing-etchedgreyorawallshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilverwing-etchedgreyorawallshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of pale grey suede straps and silver oval buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a knotwork-edged mottled green imflass pavis || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +17|| tower [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aknotwork-edgedmottledgreenimflasspavis&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aknotwork-edgedmottledgreenimflasspavis&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the pavis can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This pavis is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the pavis&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the pavis, a complex webbing of green suede straps and square faenor buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a bronze hydra-embossed eahnor aegis || Weight: 8 pounds &amp;lt;br&amp;gt;Enchant: +18|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abronzehydra-embossedeahnoraegis&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abronzehydra-embossedeahnoraegis&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the aegis can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This aegis is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the aegis&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the aegis, a complex webbing of crimson suede straps and round bronze buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a stud-edged onyx rolaren scutum || Weight: 10 pounds &amp;lt;br&amp;gt;Enchant: +20|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-astud-edgedonyxrolarenscutum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-astud-edgedonyxrolarenscutum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the scutum can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This scutum is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the scutum&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the scutum, a complex webbing of ebony leather straps and heavy black buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a cerulean griffin-crested mithglin kite shield || Weight: 9 pounds &amp;lt;br&amp;gt;Enchant: +20|| large [[shield]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aceruleangriffin-crestedmithglinkiteshield&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aceruleangriffin-crestedmithglinkiteshield&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You get a strong sense that the shield can be altered by any merchant as long as the harness remains in place.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This shield is currently Tier 1 of 2, with access to Rub*, Turn, Cower, and Batter.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;*This verb loosens straps to allow access to a stored weapon and will also, if loose, tighten to secure the weapon.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The size of the weapon that can be stored in the shield&#039;s harness is dependent on the size of the shield.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;On the reverse of the shield, a complex webbing of cerulean suede straps and square silver buckles forms an intricate arm harness.  The straps are arranged in a pattern that appears able to secure a weapon within.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144614</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144614"/>
		<updated>2021-02-13T18:52:30Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144612</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144612"/>
		<updated>2021-02-13T18:49:35Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
{{TOCright|limit=2}}&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2020Q3}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Hand-N-Hand|Hand-N-Hand]]=={{#section:BVShop:Hand-N-Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2020Q3}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2020Q3}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144609</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144609"/>
		<updated>2021-02-13T18:28:12Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
{{TOCright|limit=2}}&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2020Q3}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Hand-N-Hand|Hand-N-Hand]]=={{#section:BVShop:Hand-N-Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2020Q3}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144608</id>
		<title>Bloodriven Village/shop listing February 2021 part 1</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Bloodriven_Village/shop_listing_February_2021_part_1&amp;diff=144608"/>
		<updated>2021-02-13T18:10:39Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: &lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;div class=&amp;quot;alert alert-info&amp;quot;&amp;gt;&amp;lt;center&amp;gt;&#039;&#039;&#039;{{#section:Duskruin Arena|portals}}&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&amp;lt;big&amp;gt; [[Duskruin_Arena/Treasure_Trove_Raffles_February_2021|February Treasure Trove Information]] and [[HESS|High End Scrip Shop Listings]]&lt;br /&gt;
&amp;lt;/big&amp;gt;&#039;&#039;&#039;&amp;lt;/center&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[[File:Fest-duskruin-bloodriven-village.png|800px]]&lt;br /&gt;
{{TOCright|limit=2}}&#039;&#039;&#039;Bloodriven Village&#039;&#039;&#039; is where [[Duskruin Arena]] is located.  All purchases are made with [[bloodscrip]].&lt;br /&gt;
*[http://i.imgur.com/ZZWWOdj.png Bloodriven Village Map by Rozy]&lt;br /&gt;
*[http://forums.play.net/forums/GemStone%20IV/Paid%20Events:%20Adventures,%20Quests,%20and%20SimuCoins/Duskruin%20Arena/view Duskruin Arena Officials folder]&lt;br /&gt;
&lt;br /&gt;
{{TOCright|limit=2}}&lt;br /&gt;
==[[BVShop:A Mist Opportunity|A Mist Opportunity]]=={{#section:BVShop:A Mist Opportunity|2021Q1}}&lt;br /&gt;
==[[BVShop:Accessories_of_Crime|Accessories of Crime]]=={{#section:BVShop:Accessories_of_Crime|2021Q1}}&lt;br /&gt;
==[[BVShop:Art of Lore|Art of Lore]]=={{#section:BVShop:Art of Lore|2021Q1}}&lt;br /&gt;
==[[BVShop:At the Ready|At the Ready]]=={{#section:BVShop:At the Ready|2021Q1}}&lt;br /&gt;
==[[BVShop:Autumnal Den|Autumnal Den]]=={{#section:BVShop:Autumnal Den|2021Q1}}&lt;br /&gt;
==[[BVShop:Bare Aggression|Bare Aggression]]=={{#section:BVShop:Bare Aggression|2021Q1}}&lt;br /&gt;
==[[BVShop:Be Warez|Be Warez]]=={{#section:BVShop:Be Warez|2021Q1}}&lt;br /&gt;
==[[BVShop:Best Tressed|Best Tressed]]=={{#section:BVShop:Best Tressed|2021Q1}}&lt;br /&gt;
==[[BVShop:Blood Red Rose|Blood Red Rose]]=={{#section:BVShop:Blood Red Rose|2021Q1}}&lt;br /&gt;
==[[BVShop:Bloodriven Bowery|Bloodriven Bowery]]=={{#section:BVShop:Bloodriven Bowery|2021Q1}}&lt;br /&gt;
==[[BVShop:Covert Couriers|Covert Couriers]]=={{#section:BVShop:Covert Couriers|2020Q3}}&lt;br /&gt;
==[[BVShop:Curved Cuts|Curved Cuts]]=={{#section:BVShop:Curved Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Dunh&#039;s Lab|Dunh&#039;s Lab]]=={{#section:BVShop:Dunh&#039;s Lab|2021Q1}}&lt;br /&gt;
==[[BVShop:Hand-N-Hand|Hand-N-Hand]]=={{#section:BVShop:Hand-N-Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Spellbound|Spellbound]]=={{#section:BVShop:Spellbound|2021Q1}}&lt;br /&gt;
==[[BVShop:The Cover Up|The Cover Up]]=={{#section:BVShop:The Cover Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Written Word|Written Word]]=={{#section:BVShop:Written_Word|2021Q1}}&lt;br /&gt;
&amp;lt;!-- Move the shop out of the comment section if you&#039;ve updated it properly. --&amp;gt;&lt;br /&gt;
&amp;lt;!-- PROPERLY includes filling out the directions, lich room, map room, and shop adjective and noun for entrances. --&amp;gt; &lt;br /&gt;
&amp;lt;!--&lt;br /&gt;
==[[BVShop:Bolt_from_the_Blue|Bolt From The Blue]]=={{#section:BVShop:Bolt_from_the_Blue|2021Q1}}&lt;br /&gt;
==[[BVShop:Bundle Up|Bundle Up]]=={{#section:BVShop:Bundle Up|2021Q1}}&lt;br /&gt;
==[[BVShop:Cacographic Critters|Cacographic Critters]]=={{#section:BVShop:Cacographic Critters|2021Q1}}&lt;br /&gt;
==[[BVShop:Crosswinds and Crosshairs|Crosswinds and Crosshairs]]=={{#section:BVShop:Crosswinds and Crosshairs|2021Q1}}&lt;br /&gt;
==[[BVShop:Cultural Cuts|Cultural Cuts]]=={{#section:BVShop:Cultural Cuts|2021Q1}}&lt;br /&gt;
==[[BVShop:Cut_and_Dried|Cut and Dried]]=={{#section:BVShop:Cut_and_Dried|2021Q1}}&lt;br /&gt;
==[[BVShop:Dark and Dangerous|Dark and Dangerous]]=={{#section:BVShop:Dark_and_Dangerous|2021Q1}}&lt;br /&gt;
==[[BVShop:Den of the Poisoned Heretics|Den of the Poisoned Heretics]]=={{#section:BVShop:Den of the Poisoned Heretics|2021Q1}}&lt;br /&gt;
==[[BVShop:Drawing_the_Line|Drawing the Line]]=={{#section:BVShop:Drawing_the_Line|2021Q1}}&lt;br /&gt;
==[[BVShop:Essencetials|Essencetials]]=={{#section:BVShop:Essencetials|2021Q1}}&lt;br /&gt;
==[[BVShop:Gamac&#039;s Goods|Gamac&#039;s Goods]]=={{#section:BVShop:Gamac&#039;s Goods|2021Q1}}&lt;br /&gt;
==[[BVShop:Haunt of the Silent Investors|Haunt of the Silent Investors]]=={{#section:BVShop:Haunt of the Silent Investors|2021Q1}}&lt;br /&gt;
==[[BVShop:High Spirits|High Spirits]]=={{#section:BVShop:High Spirits|2021Q1}}&lt;br /&gt;
==[[BVShop:Just_For_Kicks|Just For Kicks]]=={{#section:BVShop:Just_For_Kicks|2021Q1}}&lt;br /&gt;
==[[BVShop:Lair of the Ophidian Cabal|Lair of the Ophidian Cabal]]=={{#section:BVShop:Lair of the Ophidian Cabal|2021Q1}}&lt;br /&gt;
==[[BVShop:Madder Hats Tea Room|Madder Hats Tea Room]]=={{#section:BVShop:Madder Hats Tea Room|2021Q1}}&lt;br /&gt;
==[[BVShop:Make Your Mark|Make Your Mark]]=={{#section:BVShop:Make Your Mark|2021Q1}}&lt;br /&gt;
==[[BVShop:Mar and Scar|Mar and Scar]]=={{#section:BVShop:Mar and Scar|2021Q1}}&lt;br /&gt;
==[[BVShop:Messy Alchemist|Messy Alchemist]]=={{#section:BVShop:Messy Alchemist|2021Q1}}&lt;br /&gt;
==[[BVShop:Mystic Phrases|Mystic Phrases]]=={{#section:BVShop:Mystic Phrases|2021Q1}}&lt;br /&gt;
==[[BVShop:Ode_to_Resistance|Ode to Resistance]]=={{#section:BVShop:Ode_to_Resistance|2021Q1}}&lt;br /&gt;
==[[BVShop:On_the_Other_Hand|On the Other Hand]]=={{#section:BVShop:On_the_Other_Hand|2021Q1}}&lt;br /&gt;
==[[BVShop:Out of the Bleak|Out of the Bleak]]=={{#section:BVShop:Out of the Bleak|2021Q1}}&lt;br /&gt;
==[[BVShop:Penitent Petitioner|Penitent Petitioner]]=={{#section:BVShop:Penitent Petitioner|2021Q1}}&lt;br /&gt;
==[[BVShop:Rock Solid|Rock Solid]]=={{#section:BVShop:Rock Solid|2021Q1}}&lt;br /&gt;
==[[BVShop:Shield Thyself|Shield Thyself]]=={{#section:BVShop:Shield Thyself|2021Q1}}&lt;br /&gt;
==[[BVShop:Sigil Shop|Sigil Shop]]=={{#section:BVShop:Sigil Shop|2021Q1}}&lt;br /&gt;
==[[BVShop:Smoke Screen|Smoke Screen]]=={{#section:BVShop:Smoke Screen|2021Q1}}&lt;br /&gt;
==[[BVShop:So Shifty|So Shifty]]=={{#section:BVShop:So Shifty|2021Q1}}&lt;br /&gt;
&lt;br /&gt;
==[[BVShop:Sprite Club|Sprite Club]]=={{#section:BVShop:Sprite Club|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Awhile and Glisten|Stay Awhile and Glisten]]=={{#section:BVShop:Stay Awhile and Glisten|2021Q1}}&lt;br /&gt;
==[[BVShop:Stay Vigilant|Stay Vigilant]]=={{#section:BVShop:Stay Vigilant|2021Q1}}&lt;br /&gt;
==[[BVShop:Temple of Tentacles|Temple of Tentacles]]=={{#section:BVShop:Temple of Tentacles|2021Q1}}&lt;br /&gt;
==[[BVShop:The Librarium|The Librarium]]=={{#section:BVShop:The Librarium|2021Q1}}&lt;br /&gt;
==[[BVShop:The Sable Quietus|The Sable Quietus]]=={{#section:BVShop:The Sable Quietus|2021Q1}}&lt;br /&gt;
==[[BVShop:Under the Counter|Under the Counter]]=={{#section:BVShop:Under the Counter|2021Q1}}&lt;br /&gt;
==[[BVShop:Untamed Spirit|Untamed Spirit]]=={{#section:BVShop:Untamed Spirit|2021Q1}}&lt;br /&gt;
==[[BVShop:Vambrace Yourself|Vambrace Yourself]]=={{#section:BVShop:Vambrace Yourself|2021Q1}}&lt;br /&gt;
==[[BVShop:Veiled Purpose|Veiled Purpose]]=={{#section:BVShop:Veiled Purpose|2021Q1}}&lt;br /&gt;
==[[BVShop:What Goes Around|What Goes Around]]=={{#section:BVShop:What Goes Around|2021Q1}}&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
[[Category: Duskruin Arena]]&lt;br /&gt;
[[Category: Bloodriven Village Shops| ]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Hand-N-Hand&amp;diff=144605</id>
		<title>BVShop:Hand-N-Hand</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Hand-N-Hand&amp;diff=144605"/>
		<updated>2021-02-13T18:07:58Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: added 2021Q1 inventory&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;__TOC__&lt;br /&gt;
==Current Inventory==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Hand-N-Hand&lt;br /&gt;
|look=a darkened doorway&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 1], Lich# 26847, go doorway&lt;br /&gt;
|fest=dr|year=2021|letter=H}}&lt;br /&gt;
===Hand-N-Hand, Parlor===&amp;lt;!--==={{{ [Hand-N-Hand, Parlor] 27651 2021-02-13 13:23:45 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Hand-N-Hand, Parlor - 27651&lt;br /&gt;
|desc=Heavy scuff marks mar the flooring in the few spots that remain visible through the blanketing layers of sand and dirt.  An iron-banded shipping trunk sits just inside the doorway, nearly blocking egress to the rest of the space.  Across the room, a short circular table draped in mildewed canvas holds merchandise on display beneath a grimy window.&lt;br /&gt;
|exits= east, out}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the short circular table you see:||contents= a barely legible parchment crumpled atop the table, a heavy vultite-studded fist-scythe, a polished azure vultite gauntlet-sword, a polished mithril-bladed katar and a thorn-spiked grey mithril hook-claw.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;a barely legible parchment crumpled atop the table&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
All of the vultite on this table has been enhanted 5 times.&lt;br /&gt;
All other materials on the table have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a heavy vultite-studded fist-scythe || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +25|| [[fist-scythe]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavyvultite-studdedfist-scythe&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavyvultite-studdedfist-scythe&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vultite-studded fist-scythe and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,250&lt;br /&gt;
|-&lt;br /&gt;
| a polished azure vultite gauntlet-sword || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +25|| [[katar]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolishedazurevultitegauntlet-sword&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolishedazurevultitegauntlet-sword&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the azure vultite gauntlet-sword and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,250&lt;br /&gt;
|-&lt;br /&gt;
| a polished mithril-bladed katar || Weight: 4 pounds &amp;lt;br&amp;gt;Enchant: +20|| [[katar]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolishedmithril-bladedkatar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolishedmithril-bladedkatar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the mithril-bladed katar and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a thorn-spiked grey mithril hook-claw || Weight: 4 pounds &amp;lt;br&amp;gt;Enchant: +20|| [[fist-scythe]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athorn-spikedgreymithrilhook-claw&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athorn-spikedgreymithrilhook-claw&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the grey mithril hook-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=In the iron-banded shipping trunk you see:||contents= a scrawled note stuffed into the trunk, a silvery white eonake troll-claw, a steel-spiked pale mithril wight-claw, an iron-studded blue vultite wight-claw, a leather-bound mithril-traced cestus and a dark leather vultite-traced cestus.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;scrawled note&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
All of the vultite and eonake in this trunk has been enhanted 5 times.&lt;br /&gt;
All other materials in the trunk have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a silvery white eonake troll-claw || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Sanctified|| [[troll-claw]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilverywhiteeonaketroll-claw&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilverywhiteeonaketroll-claw&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the eonake troll-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,750&lt;br /&gt;
|-&lt;br /&gt;
| a steel-spiked pale mithril wight-claw || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +20|| [[troll-claw]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asteel-spikedpalemithrilwight-claw&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asteel-spikedpalemithrilwight-claw&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the pale mithril wight-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an iron-studded blue vultite wight-claw || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +25|| [[troll-claw]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aniron-studdedbluevultitewight-claw&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aniron-studdedbluevultitewight-claw&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the blue vultite wight-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,250&lt;br /&gt;
|-&lt;br /&gt;
| a leather-bound mithril-traced cestus || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +20|| [[cestus]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aleather-boundmithril-tracedcestus&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aleather-boundmithril-tracedcestus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the mithril-traced cestus and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a dark leather vultite-traced cestus || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +25|| [[cestus]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adarkleathervultite-tracedcestus&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adarkleathervultite-tracedcestus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vultite-traced cestus and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=In the special display case you see:||contents= a boldly lettered scroll tucked into the case, a vine-etched glaes-studded cestus and an opalescent glaes-barbed sickle.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;boldly lettered scroll&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The weapons in this here special display case have been enchanted 6 times.&lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it too.&lt;br /&gt;
But that won&#039;t matter, cuz I bet ya can&#039;t afford em!&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a vine-etched glaes-studded cestus || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +30|| [[cestus]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avine-etchedglaes-studdedcestus&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avine-etchedglaes-studdedcestus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the glaes-studded cestus and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10,250&lt;br /&gt;
|-&lt;br /&gt;
| an opalescent glaes-barbed sickle || Weight: 6 pounds &amp;lt;br&amp;gt;Enchant: +30|| [[fist-scythe]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anopalescentglaes-barbedsickle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anopalescentglaes-barbedsickle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the glaes-barbed sickle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10,250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Hand-N-Hand&lt;br /&gt;
|look=a darkened doorway&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 1], Lich# 27651, east&lt;br /&gt;
|fest=dr|year=2021|letter=H}}&lt;br /&gt;
===Hand-N-Hand, Storage===&amp;lt;!--==={{{ [Hand-N-Hand, Storage] 27652 2021-02-13 13:31:25 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Hand-N-Hand, Storage - 27652&lt;br /&gt;
|desc=Dark paneling covers the walls in this small and dimly lit space.  Two grimy, rectangular windows are nestled in the middle of the outside wall, neither clean enough to let in any appreciable light.  A walnut chest with broken hinges lies beneath one of the windows, while a shipping crate, its lid removed, lies beneath the other.&lt;br /&gt;
|exits= west}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;walnut chest&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
           ~Caution~&lt;br /&gt;
Contents highly flammable.&lt;br /&gt;
       Handle with care.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=walnut chest||contents=There appears to be something written on it.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;written&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
           ~Caution~&lt;br /&gt;
&lt;br /&gt;
Contents highly flammable.&lt;br /&gt;
&lt;br /&gt;
       Handle with care.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{{Container2||container=In the walnut chest you see:||contents= a spindly scarlet vultite sai etched with waving flames, a barbed dark vultite troll-claw bound with scorched bracers, a polished vultite fist-scythe etched with delicate flames, a pale blue vultite katar banded with scorched leather and a scrawled note stuffed into the chest.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;scrawled note&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
Both the troll-claw and the sai in the chest have been enhanted 5 times.&lt;br /&gt;
The katar and the fist-scythe in the chest have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a spindly scarlet vultite sai etched with waving flames || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| [[sai]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aspindlyscarletvultitesaietchedwithwavingflames&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aspindlyscarletvultitesaietchedwithwavingflames&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the scarlet vultite sai and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,500&lt;br /&gt;
|-&lt;br /&gt;
| a barbed dark vultite troll-claw bound with scorched bracers || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: fire|| [[troll-claw]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abarbeddarkvultitetroll-clawboundwithscorchedbracers&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abarbeddarkvultitetroll-clawboundwithscorchedbracers&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the dark vultite troll-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,500&lt;br /&gt;
|-&lt;br /&gt;
| a polished vultite fist-scythe etched with delicate flames || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +20&amp;lt;br&amp;gt;Flares: fire|| [[fist-scythe]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apolishedvultitefist-scytheetchedwithdelicateflames&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apolishedvultitefist-scytheetchedwithdelicateflames&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vultite fist-scythe and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,000&lt;br /&gt;
|-&lt;br /&gt;
| a pale blue vultite katar banded with scorched leather || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +20&amp;lt;br&amp;gt;Flares: fire|| [[katar]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apalebluevultitekatarbandedwithscorchedleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apalebluevultitekatarbandedwithscorchedleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vultite katar and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=shipping crate||contents=There appears to be something written on it.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;written&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
           ~Caution~&lt;br /&gt;
&lt;br /&gt;
Contact may cause painful shocks.&lt;br /&gt;
&lt;br /&gt;
       Handle with care.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{{Container2||container=In the shipping crate you see:||contents= a vultite-banded tiger-claw with lightning-etched serrations, an elongated azure vultite sai dappled with silvery bolts, a scorched vultite troll-claw twined with bolt-embossed leather, a crimson vultite fist-scythe scored with jagged white bolts and a barely legible parchment crumpled in the bottom of the crate.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;barely legible parchment&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
Both the fist-scythe and the tiger-claw in the crate have been enhanted 5 times.&lt;br /&gt;
The troll-claw and the sai in the crate have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a vultite-banded tiger-claw with lightning-etched serrations || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| [[tiger-claw]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avultite-bandedtiger-clawwithlightning-etchedserrations&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avultite-bandedtiger-clawwithlightning-etchedserrations&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vultite-banded tiger-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,500&lt;br /&gt;
|-&lt;br /&gt;
| an elongated azure vultite sai dappled with silvery bolts || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +20&amp;lt;br&amp;gt;Flares: lightning|| [[sai]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anelongatedazurevultitesaidappledwithsilverybolts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anelongatedazurevultitesaidappledwithsilverybolts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the azure vultite sai and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,000&lt;br /&gt;
|-&lt;br /&gt;
| a scorched vultite troll-claw twined with bolt-embossed leather || Weight: 2 pounds &amp;lt;br&amp;gt;Enchant: +20&amp;lt;br&amp;gt;Flares: lightning|| [[troll-claw]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ascorchedvultitetroll-clawtwinedwithbolt-embossedleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ascorchedvultitetroll-clawtwinedwithbolt-embossedleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vultite troll-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,000&lt;br /&gt;
|-&lt;br /&gt;
| a crimson vultite fist-scythe scored with jagged white bolts || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +25&amp;lt;br&amp;gt;Flares: lightning|| [[fist-scythe]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acrimsonvultitefist-scythescoredwithjaggedwhitebolts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acrimsonvultitefist-scythescoredwithjaggedwhitebolts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vultite fist-scythe and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=In the special display case you see:||contents= a barbed grey vultite katar etched with jagged ivory bolts, a flame-etched crimson vultite tiger-claw and a boldly lettered scroll tucked into the case.}}&lt;br /&gt;
{{sign|margin-right=40%||sign=&#039;&#039;&#039;boldly lettered scroll&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
The weapons in this here special display case have been enchanted 6 times.&lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it too.&lt;br /&gt;
But that won&#039;t matter, cuz I bet ya can&#039;t afford em!&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a barbed grey vultite katar etched with jagged ivory bolts || Weight: 3 pounds &amp;lt;br&amp;gt;Enchant: +30&amp;lt;br&amp;gt;Flares: lightning|| [[katar]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abarbedgreyvultitekataretchedwithjaggedivorybolts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abarbedgreyvultitekataretchedwithjaggedivorybolts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the grey vultite katar and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10,500&lt;br /&gt;
|-&lt;br /&gt;
| a flame-etched crimson vultite tiger-claw || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Enchant: +30&amp;lt;br&amp;gt;Flares: fire|| [[tiger-claw]]&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aflame-etchedcrimsonvultitetiger-claw&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflame-etchedcrimsonvultitetiger-claw&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the crimson vultite tiger-claw and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10,500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
==Previous Inventory==&lt;br /&gt;
&amp;lt;section begin=current /&amp;gt;&amp;lt;includeonly&amp;gt;&lt;br /&gt;
==Hand-N-Hand==&lt;br /&gt;
&amp;lt;/includeonly&amp;gt;&#039;&#039;&#039;Opened&#039;&#039;&#039;: December 2018; &#039;&#039;&#039;Inventory Updates&#039;&#039;&#039;: None; &#039;&#039;&#039;Verified:&#039;&#039;&#039; 12/20/18, 8/12/2019, 2/13/2020&lt;br /&gt;
&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Hand-N-Hand&lt;br /&gt;
|look=a darkened doorway&lt;br /&gt;
|location=Map #1, Lich #27651, go darkened doorway&lt;br /&gt;
}}&lt;br /&gt;
===Hand-N-Hand Parlor===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Hand-N-Hand, Parlor&lt;br /&gt;
|desc=Heavy scuff marks mar the flooring in the few spots that remain visible through the blanketing layers of sand and dirt.  An iron-banded shipping trunk sits just inside the doorway, nearly blocking egress to the rest of the space.  Across the room, a short circular table draped in mildewed canvas holds merchandise on display beneath a grimy window.&lt;br /&gt;
|exits = east, out}}&lt;br /&gt;
&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{sign|margin-right=25%&lt;br /&gt;
|sign=All of the vultite on this table has been enhanted 5 times.&lt;br /&gt;
All other materials on the table have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&lt;br /&gt;
}}&lt;br /&gt;
&#039;&#039;&#039;ANALYZE:&lt;br /&gt;
&amp;lt;pre{{log2}}&amp;gt;&lt;br /&gt;
This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;/pre&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short circular table you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bonus&lt;br /&gt;
!bgcolor=#DDDDDD|Weapon Profile&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
|-&lt;br /&gt;
| a hide-wrapped mithril fist-scythe || 4x ||[[fist-scythe]]|| 750&lt;br /&gt;
|-&lt;br /&gt;
| a dual-bladed mithril gauntlet-sword || 4x ||[[katar]]|| 750&lt;br /&gt;
|-&lt;br /&gt;
| a dual-bladed silvery vultite gauntlet-sword || 5x ||[[katar]]|| 2250&lt;br /&gt;
|-&lt;br /&gt;
| a rune-etched silvery vultite fist-scythe || 5x ||[[fist-scythe]]|| 2250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{sign|margin-right=25%&lt;br /&gt;
|sign=All of the vultite and eonake in this trunk has been enhanted 5 times.&lt;br /&gt;
All other materials in the trunk have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the iron-banded shipping trunk you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bonus&lt;br /&gt;
!bgcolor=#DDDDDD|Weapon Profile&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
|-&lt;br /&gt;
| a pale leather vultite-studded cestus || 5x ||[[cestus]]|| 2250&lt;br /&gt;
|-&lt;br /&gt;
| a red leather mithril-studded cestus || 4x ||[[cestus]]|| 750&lt;br /&gt;
|-&lt;br /&gt;
| an iron-braced vultite troll-claw || 5x ||[[troll-claw]]|| 2250&lt;br /&gt;
|-&lt;br /&gt;
| an steel-braced mithril troll-claw || 4x ||[[troll-claw]]|| 750&lt;br /&gt;
|-&lt;br /&gt;
| a polished eonake troll-claw || 5x, sancted ||[[troll-claw]]|| 2750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{sign|margin-right=25%&lt;br /&gt;
|sign=The weapons in this here special display case have been enchanted 6 times.&lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it too.&lt;br /&gt;
But that won&#039;t matter, cuz I bet ya can&#039;t afford em!&lt;br /&gt;
}}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the special display case you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bonus&lt;br /&gt;
!bgcolor=#DDDDDD|Weapon Profile&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
|-&lt;br /&gt;
| a glossy ebon glaes fist-scythe || 6x ||[[fist-scythe]]|| 10250&lt;br /&gt;
|-&lt;br /&gt;
| a red leather glaes-studded cestus|| 6x ||[[cestus]]|| 10250&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Hand-N-Hand, Storage===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Hand-N-Hand, Storage&lt;br /&gt;
|desc=Dark panelling covers the walls in this small and dimly lit space.  Two grimy, rectangular windows are nestled in the middle of the outside wall, neither clean enough to let in any appreciable light.  A walnut chest with broken hinges lies beneath one of the windows, while a shipping crate, its lid removed, lies beneath the other.&lt;br /&gt;
|exits = west}}&lt;br /&gt;
{{sign|&lt;br /&gt;
|sign=           ~Caution~&lt;br /&gt;
Contents highly flammable.&lt;br /&gt;
       Handle with care.}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{sign|margin-right=25%&lt;br /&gt;
|sign=Both the troll-claw and the sai in the chest have been enhanted 5 times.&lt;br /&gt;
The katar and the fist-scythe in the chest have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&lt;br /&gt;
}}&lt;br /&gt;
&#039;&#039;&#039;ANALYZE:&lt;br /&gt;
&amp;lt;pre{{log2}}&amp;gt;&lt;br /&gt;
This is a brawling weapon with fluff messaging.  It can be altered normally.&amp;lt;br&amp;gt;This item is currently off-the-shelf quality.  It can be unlocked further by a qualified merchant.  It currently traps: PULL, PUSH, TURN, and RAISE.&amp;lt;/pre&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the walnut chest you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bonus &amp;amp; Flare&lt;br /&gt;
!bgcolor=#DDDDDD|Weapon Profile&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
|-&lt;br /&gt;
| a silvery vultite katar with scorch-marked crosspieces || 4x, fire||[[katar]]|| 1000&lt;br /&gt;
|-&lt;br /&gt;
| a flame-etched vultite fist-scythe || 4x, fire ||[[fist-scythe]]|| 1000&lt;br /&gt;
|-&lt;br /&gt;
| a sturdy vultite troll-claw with scorched bracers || 5x, fire ||[[troll-claw]]|| 2500&lt;br /&gt;
|-&lt;br /&gt;
| a dual-pronged crimson vultite sai etched with tiny flames || 4x, fire||[[sai]]|| 2500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{sign|margin-right=25%&lt;br /&gt;
|sign=Both the fist-scythe and the tiger-claw in the crate have been enhanted 5 times.&lt;br /&gt;
The troll-claw and the sai in the crate have been enchanted 4 times. &lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it.&lt;br /&gt;
}}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the shipping crate you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bonus &amp;amp; Flare&lt;br /&gt;
!bgcolor=#DDDDDD|Weapon Profile&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
|-&lt;br /&gt;
| a polished vultite fist-scythe etched with a jagged white bolt || 5x, lightning ||[[fist-scythe]]|| 2500&lt;br /&gt;
|-&lt;br /&gt;
| a silvery vultite troll-claw bound with bolt-embossed leather|| 4x, lightning ||[[troll-claw]]|| 1000&lt;br /&gt;
|-&lt;br /&gt;
| a dual-pronged vultite sai painted with a jagged silver bolt || 4x, lightning ||[[sai]]|| 1000&lt;br /&gt;
|-&lt;br /&gt;
| a sharp vultite tiger-claw etched with lightning bolts || 5x, lightning ||[[tiger-claw]]|| 2500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{sign|margin-right=25%&lt;br /&gt;
|sign=The weapons in this here special display case have been enchanted 6 times.&lt;br /&gt;
Each weapon has a extra bit of fluffy zestiness to it too.&lt;br /&gt;
But that won&#039;t matter, cuz I bet ya can&#039;t afford em!&lt;br /&gt;
}}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the special display case you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bonus &amp;amp; Flare&lt;br /&gt;
!bgcolor=#DDDDDD|Weapon Profile&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
|-&lt;br /&gt;
| a flame-etched vultite tiger-claw|| 6x, fire ||[[tiger-claw]]|| 10500&lt;br /&gt;
|-&lt;br /&gt;
| a silvery vultite katar etched with a jagged white bolt || 6x, lightning ||[[katar]]|| 10500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;section end=current /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&amp;lt;!-- ==Archived Inventory==&lt;br /&gt;
&amp;lt;section begin=archive /&amp;gt;&amp;lt;includeonly&amp;gt;&lt;br /&gt;
==Shop Name==&lt;br /&gt;
&amp;lt;/includeonly&amp;gt;&lt;br /&gt;
&lt;br /&gt;
====Removed: &amp;lt;DATE&amp;gt;====&lt;br /&gt;
Archived Items&lt;br /&gt;
&amp;lt;section end=archive /&amp;gt;&lt;br /&gt;
--&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[[Category: Bloodriven Village Shops|H]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:Spellbound&amp;diff=144556</id>
		<title>BVShop:Spellbound</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:Spellbound&amp;diff=144556"/>
		<updated>2021-02-13T15:02:59Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: /* 2021Q1 */ added additional room information&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;&amp;lt;!-- begin wiki output --&amp;gt;&lt;br /&gt;
&amp;lt;!-- Shop:Spellbound --&amp;gt;&lt;br /&gt;
&amp;lt;!--__TOC__--&amp;gt;&lt;br /&gt;
==2021Q1==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Spellbound&lt;br /&gt;
|look=a narrow space between two buildings&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room 3], Lich# 26877, go space&lt;br /&gt;
|fest=dr|year=2021|letter=S}}&lt;br /&gt;
===Spellbound===&amp;lt;!--==={{{ [Spellbound] 26878 2021-02-13 02:28:37 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Spellbound - 26878&lt;br /&gt;
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else.  A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall.  Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate.&lt;br /&gt;
|exits= south, out}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;dust-covered note&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
Items in the case are magical trinkets which automatically recharge daily:&lt;br /&gt;
Green Mossbark Wand: Wild Entropy (603) - 40x/day&lt;br /&gt;
White Ora Rod: Condemn (309) - 40x/day&lt;br /&gt;
Twisted Crystal Wand: Phase (704) - 40x/day&lt;br /&gt;
Earthen Brock Rock Trinket: Tremors (909) - 40x/day&lt;br /&gt;
White Eonake Cross: Remove Curse (315) - 3x/day&lt;br /&gt;
Golden Shield Pin: Mantle of Faith (1601) - 3x/day&lt;br /&gt;
Blue Quartz Pin: Mindward (1208) - 1x/day&lt;br /&gt;
Small Statue Clasp: Spirit Guard (1712) - 1x/day&lt;br /&gt;
Shiny Gold Coin Pin: Arcane Decoy (1701) - 20x/day&lt;br /&gt;
Green Leaf Symbol: Phoen&#039;s Strength (606) - 1x/day&lt;br /&gt;
Shiny Knight Symbol: Dauntless (1606) - 1x/day&lt;br /&gt;
Pearl-edged White Ora Cube: Benediction (307) - 1x/day&lt;br /&gt;
Bright Yellow Potion Trinket: Adrenal Surge (1107) - 3x/day&lt;br /&gt;
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer&#039;s preferred deity.&lt;br /&gt;
New potions on the shelf!  The absinthe green tincture significantly increases one&#039;s enchanting skill and comes with 5 doses (new style Enchanting only!).  The pearlescent purple philter significantly increases one&#039;s ensorcelling skill and comes with 1 dose.  The blue-violet infusion significantly increases one&#039;s loresong unlocking skill and comes with 1 dose.  Lastly, the dilute copper ayan&#039;eth potions (8x), dilute silver ayan&#039;eth potions (9x), and dilute golden ayan&#039;eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=In the sigil-incised display case you see:||contents= a blackened green mossbark wand, an elegant white ora rod, a twisted crystal wand, an earthen brown rock trinket, a gleaming white eonake cross, a dazzling golden shield pin, a blue quartz symbol, a small statue clasp, a shiny gold coin pin, a green leaf symbol, a metallic shiny knight symbol, a pearl-edged white ora cube engraved with variegated symbols and a bright yellow potion trinket.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a blackened green mossbark wand || Weight: &amp;lt;1 pound || || [[Wild Entropy]]&amp;lt;br&amp;gt;40 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;wave activated || 10,000&lt;br /&gt;
|-&lt;br /&gt;
| an elegant white ora rod || Weight: &amp;lt;1 pound || || [[Condemn]]&amp;lt;br&amp;gt;40 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;wave activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
| a twisted crystal wand || Weight: &amp;lt;1 pound || || [[Phase]]&amp;lt;br&amp;gt;40 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;wave activated || 10,000&lt;br /&gt;
|-&lt;br /&gt;
| an earthen brown rock trinket || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Tremors]]&amp;lt;br&amp;gt;40 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;rub activated || 20,000&lt;br /&gt;
|-&lt;br /&gt;
| a gleaming white eonake cross || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Remove Curse]]&amp;lt;br&amp;gt;3 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;rub activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
| a dazzling golden shield pin || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Mantle of Faith]]&amp;lt;br&amp;gt;3 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;raise activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
| a blue quartz symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Mindward]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;raise activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
| a small statue clasp || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Spirit Guard]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;raise activated || 20,000&lt;br /&gt;
|-&lt;br /&gt;
| a shiny gold coin pin || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Arcane Decoy]]&amp;lt;br&amp;gt;20 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;rub activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
| a green leaf symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Phoen&#039;s Strength]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;raise activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
| a metallic shiny knight symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Dauntless]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;raise activated || 20,000&lt;br /&gt;
|-&lt;br /&gt;
| a pearl-edged white ora cube engraved with variegated symbols || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Benediction]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;raise activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
| a bright yellow potion trinket || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Adrenal Surge]]&amp;lt;br&amp;gt;3 charges&amp;lt;br&amp;gt;persists&amp;lt;br&amp;gt;rub activated || 15,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=In the rune-covered wooden crate you see:||contents= a heavy invar necklace set with square-cut rubies, a diamond-linked silver necklace dangling tiny sapphires and a twisted rose gold necklace accented with dark aquamarine rosettes.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a heavy invar necklace set with square-cut rubies || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavyinvarnecklacesetwithsquare-cutrubies&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavyinvarnecklacesetwithsquare-cutrubies&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the invar necklace and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25,000&lt;br /&gt;
|-&lt;br /&gt;
| a diamond-linked silver necklace dangling tiny sapphires || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adiamond-linkedsilvernecklacedanglingtinysapphires&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adiamond-linkedsilvernecklacedanglingtinysapphires&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the silver necklace and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25,000&lt;br /&gt;
|-&lt;br /&gt;
| a twisted rose gold necklace accented with dark aquamarine rosettes || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the rose gold necklace and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;The necklace is made from a perfect sphere of polished opal.  Pearlescent light shines out in a luminous crescent from the stone, reflecting Lornon&#039;s current first half phase.  A simple setting of pure platinum holds the miniature moon.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the small round table you see:||contents= a smoke-tinted rolaren monocle, a rose-tinged bronze monocle, a silver squiggly-framed monocle and a filigreed gold-tinted monocle.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a smoke-tinted rolaren monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmoke-tintedrolarenmonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmoke-tintedrolarenmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the rolaren monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A smoke-tinted rolaren monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,500&lt;br /&gt;
|-&lt;br /&gt;
| a rose-tinged bronze monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-arose-tingedbronzemonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-arose-tingedbronzemonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the bronze monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A rose-tinged bronze monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,500&lt;br /&gt;
|-&lt;br /&gt;
| a silver squiggly-framed monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilversquiggly-framedmonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilversquiggly-framedmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the squiggly-framed monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A silver squiggly-framed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,500&lt;br /&gt;
|-&lt;br /&gt;
| a filigreed gold-tinted monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afiligreedgold-tintedmonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afiligreedgold-tintedmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the gold-tinted monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A filigreed gold-tinted monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a shimmering trinket, a smooth turquoise leather journal embossed with a peacock feather, an ivory suede-spined gold puma fur-covered ledger, a translucent gold and teal bottle, a twine-wrapped smoky grey jar, a gold-leafed shimmering pink bottle, a black-eyed skull-shaped jar, a shimmering certificate, a glittering ticket, a dilute golden ayan&#039;eth potion, a dilute silver ayan&#039;eth potion, a dilute copper ayan&#039;eth potion, a pale blue-violet infusion, an absinthe green tincture and a pearlescent purple philter.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a shimmering trinket || Weight: &amp;lt;1 pound || pin-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashimmeringtrinket&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashimmeringtrinket&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;The shimmering trinket is a &amp;quot;Shimmer Trinket&amp;quot;, which can store the appearance of wearable items and project them over your normal clothing when it&#039;s worn.  Just wear whatever items you want in whatever order you desire, then ATTEND the trinket.  Once worn, it will only display those items while concealing all others.  You may also CLEAN it to remove the previously stored appearance.  If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on.  TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description).  PUSH will rotate between the available appearance sets.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;It is not currently active, but is using set 1 (out of 1): nothing special at this time.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants.  A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5,000&lt;br /&gt;
|-&lt;br /&gt;
| a smooth turquoise leather journal embossed with a peacock feather || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmoothturquoiseleatherjournalembossedwithapeacockfeather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmoothturquoiseleatherjournalembossedwithapeacockfeather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This leather journal is a heavily scripted fluff book.  It can be altered freely so long as it remains a book.&amp;lt;br&amp;gt;&lt;br /&gt;
 Traps:  CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE&amp;lt;br&amp;gt;&lt;br /&gt;
          TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,000&lt;br /&gt;
|-&lt;br /&gt;
| an ivory suede-spined gold puma fur-covered ledger || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anivorysuede-spinedgoldpumafur-coveredledger&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anivorysuede-spinedgoldpumafur-coveredledger&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This fur-covered ledger is a heavily scripted fluff book.  It can be altered freely so long as it remains a book.&amp;lt;br&amp;gt;&lt;br /&gt;
 Traps:  CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE&amp;lt;br&amp;gt;&lt;br /&gt;
          TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2,000&lt;br /&gt;
|-&lt;br /&gt;
| a translucent gold and teal bottle || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;50 items || 100&lt;br /&gt;
|-&lt;br /&gt;
| a twine-wrapped smoky grey jar || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;50 items || 100&lt;br /&gt;
|-&lt;br /&gt;
| a gold-leafed shimmering pink bottle || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;100 items || 250&lt;br /&gt;
|-&lt;br /&gt;
| a black-eyed skull-shaped jar || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;100 items || 250&lt;br /&gt;
|-&lt;br /&gt;
| a shimmering certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashimmeringcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashimmeringcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the shimmering certificate.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,000&lt;br /&gt;
|-&lt;br /&gt;
| a glittering ticket || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aglitteringticket&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aglitteringticket&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your ticket is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The glittering ticket will add 1 appearance set to an existing Shimmer Trinket.  No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your ticket may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You glance at the glittering ticket.&amp;lt;br&amp;gt;&lt;br /&gt;
You notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket.  No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100.  i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 3,500&lt;br /&gt;
|-&lt;br /&gt;
| a dilute golden ayan&#039;eth potion || Weight: 2 pounds || ||  || 30,000&lt;br /&gt;
|-&lt;br /&gt;
| a dilute silver ayan&#039;eth potion || Weight: 2 pounds || ||  || 25,000&lt;br /&gt;
|-&lt;br /&gt;
| a dilute copper ayan&#039;eth potion || Weight: 2 pounds || ||  || 20,000&lt;br /&gt;
|-&lt;br /&gt;
| a pale blue-violet infusion || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apaleblue-violetinfusion&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apaleblue-violetinfusion&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this infusion.  A bard may be able to provide more specifics.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10,000&lt;br /&gt;
|-&lt;br /&gt;
| an absinthe green tincture || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anabsinthegreentincture&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anabsinthegreentincture&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this tincture.  A bard may be able to provide more specifics.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50,000&lt;br /&gt;
|-&lt;br /&gt;
| a pearlescent purple philter || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-apearlescentpurplephilter&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-apearlescentpurplephilter&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this philter.  A bard may be able to provide more specifics.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50,000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Spellbound&lt;br /&gt;
|look=a narrow space between two buildings&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room #], Lich# 26878, south&lt;br /&gt;
|fest=dr|year=2021|letter=S}}&lt;br /&gt;
===Spellbound, Crevice===&amp;lt;!--==={{{ [Spellbound, Crevice] 26881 2021-02-13 10:25:39 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Spellbound, Crevice - 26881&lt;br /&gt;
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall.  Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. &lt;br /&gt;
|exits= north}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the dilapidated birch shelf you see:||contents= a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpsest and a thin shadowy black parchment.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a smooth off-white vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmoothoff-whitevellum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmoothoff-whitevellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures.  Your anthracite eyes flash with a holy light as you release the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Cajoling the lesser spirits, Maetriks utters a lyrical prayer that is accompanied by simple gestures.  Her anthracite eyes flash with a holy light as she releases her spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  103&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a translucent cream-hued vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-atranslucentcream-huedvellum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-atranslucentcream-huedvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Closing your eyes tightly, you concentrate on an image within your mind&#039;s eye and murmur a soft prayer to the spirits.  As the last syllable falls from your lips, your anthracite eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Closing her eyes tightly, Maetriks appears to be concentrating for several seconds as she murmurs a soft prayer to the spirits.  As the last syllable falls from her lips, her anthracite eyes fly wide open and she flicks her fingers, releasing her spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Anthracite light suddenly flashes in the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  116&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a silvery lightning-motif vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilverylightning-motifvellum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilverylightning-motifvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will.  Zorchar energy crackles across the surface of your smooth, immaculately pallid skin as you release the stored energy of the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Curling her fingers into claws, Maetriks forcefully confronts the spirits and demands that they mold themselves to her will.  Zorchar energy crackles across the surface of her smooth, immaculately pallid skin as she releases the stored energy of her spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Zorchar energy crackles through the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  125&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a small scale-shaped parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmallscale-shapedparchment&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmallscale-shapedparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Sibilantly forming the simple words of her prayer, Maetriks implores shadows and darkness to protect her.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Sibilant prayers issue from the darkness.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  303&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an inky black palimpsest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aninkyblackpalimpsest&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aninkyblackpalimpsest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this black palimpsest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond.  Slowly, darkness seeps from your anthracite eyes and transforms into a [Spell Name] before you...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Flexing her fingers slightly, Maetriks&#039;s form begins to darken and shadows seep from her anthracite eyes.  Maetriks releases her spell by transforming that darkness around her into a spiritual shield.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Darkness briefly pools about the area.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  202&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a thin shadowy black parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athinshadowyblackparchment&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athinshadowyblackparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Tenebrous shadows slip across your smooth, immaculately pallid skin as you demand divinity to heed your prayers.  As if in answer, a darkness falls across your vision and you release your [Spell Name]...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Tenebrous shadows slip across Maetriks&#039;s smooth, immaculately pallid skin as she demands divinity to heed her prayers.  As if in answer, her anthracite eyes briefly blacken as she releases her fury.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  317&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the decaying oaken slab you see:||contents= a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a coin-edged piece of sheet music || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acoin-edgedpieceofsheetmusic&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acoin-edgedpieceofsheetmusic&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Humming a familiar ditty about a knave found on the wrong side of a door, Maetriks weaves the simple somatic components of a spell into the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Rising on the air is a familiar ditty.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  403&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a sheet of watermarked music || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asheetofwatermarkedmusic&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asheetofwatermarkedmusic&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals.  As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Lifting her voice in song, Maetriks spins a quick tale involving a small child trying to discover the mysteries of water elementals.  As she sings, she weaves her fingers in a complicated pattern that mimics the cadence of her tune and in the process, casts a spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  A simple song about a small child trying to discover the mysteries of water elementals rises on the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  405&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a violet cotton sheet || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avioletcottonsheet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avioletcottonsheet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Tracing simple lines upon your smooth, immaculately pallid brow, you invoke the elements and implore them to give you deeper insight.  Within seconds, a third anthracite eye opens in your forehead as you cast the [Spell Name] spell.  The eye fades in a matter of moments...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Tracing simple lines upon her smooth, immaculately pallid brow, Maetriks invokes the elements and almost instantly a third anthracite eye opens in her forehead.  Seconds after she releases the spell, the eye fades away.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  416&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a soft sigil-etched sheet || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asoftsigil-etchedsheet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asoftsigil-etchedsheet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Tracing sigils in the air, each briefly illuminating in various brilliant hues, Maetriks invokes the elements as she casts her spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  419&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a whorl-edged cloud white note || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awhorl-edgedcloudwhitenote&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awhorl-edgedcloudwhitenote&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud.  Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Drawing her fingers through the air, Maetriks&#039;s movements gradually become sluggish as she finishes the somatic components of her spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  504&lt;br /&gt;
&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==2020Q3==&lt;br /&gt;
&amp;lt;section begin=2020Q3 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Spellbound&lt;br /&gt;
|look=narrow space between two buildings&lt;br /&gt;
|location=[Map Room #16], Lich# 26877, go narrow space&lt;br /&gt;
|fest=dr|year=2020|letter=S}}&lt;br /&gt;
===Spellbound===&amp;lt;!--==={{{ [Spellbound] 26878 2020-08-14 21:03:27 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Spellbound - 26878&lt;br /&gt;
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else.  A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall.  Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate.  You also see a wave-painted brick door.&lt;br /&gt;
|exits= south, out}}&lt;br /&gt;
{{sign|margin-right=40%|sign=&#039;&#039;&#039;dust-covered note&#039;&#039;&#039;&amp;lt;hr&amp;gt;&amp;lt;nowiki&amp;gt;&lt;br /&gt;
Items in the case are magical trinkets which automatically recharge daily:&lt;br /&gt;
Gold Coin Pin: Arcane Decoy (1701) - 20x/day&lt;br /&gt;
Wizard Hat Symbol: Mage Armor (520) - 1x/day&lt;br /&gt;
Twisted Twig Trinket: Self Control (613) - 1x/day&lt;br /&gt;
Prismatic Clasp: Prismatic Guard (905) - 3x/day&lt;br /&gt;
Cloak Clasp: Cloak of Shadows (712) - 1x/day&lt;br /&gt;
Curved Sigil: Elemental Bias (508) - 1x/day&lt;br /&gt;
Square Stickpin: Prayer (313) - 1x/day&lt;br /&gt;
Shiny Knight Symbol: Dauntless (1606) - 1x/day&lt;br /&gt;
Citrine Quartz Pin: Fash&#039;lo&#039;nae&#039;s Gift (1750) - 1x/day&lt;br /&gt;
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer&#039;s preferred deity.&lt;br /&gt;
New potions on the shelf!  The viscous opalescent brew significantly increases one&#039;s enchanting skill and comes with 5 doses (new style Enchanting only!).  The draught significantly increases one&#039;s ensorcelling skill and comes with 1 dose.  The cordial significantly increases one&#039;s loresong unlocking skill and comes with 1 dose.  Lastly, the dilute copper ayan&#039;eth potions (8x), dilute silver ayan&#039;eth potions (9x), and dilute golden ayan&#039;eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.&amp;lt;/nowiki&amp;gt;}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=In the sigil-incised display case you see:||contents= a shiny gold coin pin, a small wizard hat symbol, a small twisted twig trinket, a smooth prismatic clasp, a dark cloak clasp, a silvery curved sigil, a white square stickpin and a metallic shiny knight symbol.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a shiny gold coin pin || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Arcane Decoy]]&amp;lt;br&amp;gt;20 charges || 15000&lt;br /&gt;
|-&lt;br /&gt;
| a small wizard hat symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Mage Armor]]&amp;lt;br&amp;gt;1 charge || 20000&lt;br /&gt;
|-&lt;br /&gt;
| a small twisted twig trinket || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Self Control]]&amp;lt;br&amp;gt;1 charge || 20000&lt;br /&gt;
|-&lt;br /&gt;
| a smooth prismatic clasp || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Prismatic Guard]]&amp;lt;br&amp;gt;3 charges || 15000&lt;br /&gt;
|-&lt;br /&gt;
| a dark cloak clasp || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Cloak of Shadows]]&amp;lt;br&amp;gt;1 charge || 20000&lt;br /&gt;
|-&lt;br /&gt;
| a silvery curved sigil || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Elemental Bias]]&amp;lt;br&amp;gt;1 charge || 20000&lt;br /&gt;
|-&lt;br /&gt;
| a white square stickpin || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Prayer]]&amp;lt;br&amp;gt;1 charge || 20000&lt;br /&gt;
|-&lt;br /&gt;
| a metallic shiny knight symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Dauntless]]&amp;lt;br&amp;gt;1 charge || 20000&lt;br /&gt;
|-&lt;br /&gt;
| a slit-pupiled citrine quartz pin || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional|| [[Fash&#039;lo&#039;nae&#039;s Gift]]&amp;lt;br&amp;gt;1 charge || 100000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=Under the sigil-incised display case you see:||contents= a blackened silver necklace set with an orb-caged white pearl, an oval-linked electrum necklace set with a cylinder-caged crimson blazestar and a slender vaalin necklace set with a square-caged silver starstone.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a blackened silver necklace set with an orb-caged white pearl || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the silver necklace and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25000&lt;br /&gt;
|-&lt;br /&gt;
| an oval-linked electrum necklace set with a cylinder-caged crimson blazestar || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the electrum necklace and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25000&lt;br /&gt;
|-&lt;br /&gt;
| a slender vaalin necklace set with a square-caged silver starstone || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the vaalin necklace and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the small round table you see:||contents= a violet-tinted electrum monocle, a reflective gold-rimmed monocle, a bent-framed brass monocle and a heavy invar monocle.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a violet-tinted electrum monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aviolet-tintedelectrummonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aviolet-tintedelectrummonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the electrum monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
| a reflective gold-rimmed monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-areflectivegold-rimmedmonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-areflectivegold-rimmedmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the gold-rimmed monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
| a bent-framed brass monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abent-framedbrassmonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abent-framedbrassmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the brass monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
| a heavy invar monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavyinvarmonocle&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavyinvarmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;You analyze the invar monocle and sense that the creator has provided the following information:&amp;lt;br&amp;gt;&lt;br /&gt;
A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;&lt;br /&gt;
This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;&lt;br /&gt;
Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;&lt;br /&gt;
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a shimmering trinket, a dog-eared brown suede tome, an immaculate white leather codex, a bulbous vibrant crimson bottle, a gold-caged lustrous green jar, a silver-chased dark purple bottle, a squat pale pink jar, a shimmering certificate, a glittering ticket, a dilute golden ayan&#039;eth potion, a dilute silver ayan&#039;eth potion, a dilute copper ayan&#039;eth potion, a foamy amber cordial, a viscous opalescent brew and a bubbling bright green draught.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a shimmering trinket || Weight: &amp;lt;1 pound || pin-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashimmeringtrinket&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashimmeringtrinket&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;The shimmering trinket is a &amp;quot;Shimmer Trinket&amp;quot;, which can store the appearance of wearable items and project them over your normal clothing when it&#039;s worn.  Just wear whatever items you want in whatever order you desire, then ATTEND the trinket.  Once worn, it will only display those items while concealing all others.  You may also CLEAN it to remove the previously stored appearance.  If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on.  TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description).  PUSH will rotate between the available appearance sets.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;It is not currently active, but is using set 1 (out of 1): nothing special at this time.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants.  A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5000&lt;br /&gt;
|-&lt;br /&gt;
| a dog-eared brown suede tome || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adog-earedbrownsuedetome&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adog-earedbrownsuedetome&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This brown suede tome is a heavily scripted fluff book.  It can be altered freely so long as it remains a book.&amp;lt;br&amp;gt;&lt;br /&gt;
 Traps:  CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE&amp;lt;br&amp;gt;&lt;br /&gt;
          TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2000&lt;br /&gt;
|-&lt;br /&gt;
| an immaculate white leather codex || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-animmaculatewhiteleathercodex&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-animmaculatewhiteleathercodex&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This white leather codex is a heavily scripted fluff book.  It can be altered freely so long as it remains a book.&amp;lt;br&amp;gt;&lt;br /&gt;
 Traps:  CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE&amp;lt;br&amp;gt;&lt;br /&gt;
          TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2000&lt;br /&gt;
|-&lt;br /&gt;
| a bulbous vibrant crimson bottle || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;50 items || 100&lt;br /&gt;
|-&lt;br /&gt;
| a gold-caged lustrous green jar || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;50 items || 100&lt;br /&gt;
|-&lt;br /&gt;
| a silver-chased dark purple bottle || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;100 items || 250&lt;br /&gt;
|-&lt;br /&gt;
| a squat pale pink jar || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| || [[Alchemy_jar|Alchemy jar]]&amp;lt;br&amp;gt;100 items || 250&lt;br /&gt;
|-&lt;br /&gt;
| a shimmering certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashimmeringcertificate&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashimmeringcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;As you glance over the certificate you notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1000&lt;br /&gt;
|-&lt;br /&gt;
| a glittering ticket || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aglitteringticket&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aglitteringticket&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt; Your ticket is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; The glittering ticket will add 1 appearance set to an existing Shimmer Trinket.  No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt; Your ticket may not be altered or changed in any way.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;As you glance over the ticket you notice something written on it...&amp;lt;br&amp;gt;&lt;br /&gt;
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket.  No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100.  i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 3500&lt;br /&gt;
|-&lt;br /&gt;
| a dilute golden ayan&#039;eth potion || Weight: 2 pounds || ||  || 30000&lt;br /&gt;
|-&lt;br /&gt;
| a dilute silver ayan&#039;eth potion || Weight: 2 pounds || ||  || 25000&lt;br /&gt;
|-&lt;br /&gt;
| a dilute copper ayan&#039;eth potion || Weight: 2 pounds || ||  || 20000&lt;br /&gt;
|-&lt;br /&gt;
| a foamy amber cordial || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afoamyambercordial&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afoamyambercordial&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this cordial.  A bard may be able to provide more specifics.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10000&lt;br /&gt;
|-&lt;br /&gt;
| a viscous opalescent brew || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aviscousopalescentbrew&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aviscousopalescentbrew&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew.  A bard may be able to provide more specifics.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50000&lt;br /&gt;
|-&lt;br /&gt;
| a bubbling bright green draught || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abubblingbrightgreendraught&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abubblingbrightgreendraught&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught.  A bard may be able to provide more specifics.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Spellbound&lt;br /&gt;
|look=&amp;lt;!--#shop look, the outside: e.g. pink tent with a mustache painted on the side--&amp;gt;&lt;br /&gt;
|location=[Map Room #], Lich# 26878, south&lt;br /&gt;
|fest=dr|year=2020|letter=S}}&lt;br /&gt;
&lt;br /&gt;
===Spellbound, Crevice===&amp;lt;!--==={{{ [Spellbound, Crevice] 26881 2020-08-14 21:04:35 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Spellbound, Crevice - 26881&lt;br /&gt;
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall.  Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. &lt;br /&gt;
|exits= north}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the dilapidated birch shelf you see:||contents= a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpest and a thin shadowy black parchment.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a smooth off-white vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmoothoff-whitevellum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmoothoff-whitevellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures.  Your umber eyes flash with a holy light as you release the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Cajoling the lesser spirits, Xanlin utters a lyrical prayer that is accompanied by simple gestures.  His umber eyes flash with a holy light as he releases his spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  103&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a translucent cream-hued vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-atranslucentcream-huedvellum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-atranslucentcream-huedvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Closing your eyes tightly, you concentrate on an image within your mind&#039;s eye and murmur a soft prayer to the spirits.  As the last syllable falls from your lips, your umber eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Closing his eyes tightly, Xanlin appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits.  As the last syllable falls from his lips, his umber eyes fly wide open and he flicks his fingers, releasing his spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Umber light suddenly flashes in the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  116&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a silvery lightning-motif vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilverylightning-motifvellum&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilverylightning-motifvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will.  Zorchar energy crackles across the surface of your sun-kissed, lightly freckled skin as you release the stored energy of the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Curling his fingers into claws, Xanlin forcefully confronts the spirits and demands that they mold themselves to his will.  Zorchar energy crackles across the surface of his sun-kissed, lightly freckled skin as he releases the stored energy of his spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Zorchar energy crackles through the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  125&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a small scale-shaped parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmallscale-shapedparchment&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmallscale-shapedparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Sibilantly forming the simple words of his prayer, Xanlin implores shadows and darkness to protect him.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Sibilant prayers issue from the darkness.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  303&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an inky black palimpest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aninkyblackpalimpest&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aninkyblackpalimpest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond.  Slowly, darkness seeps from your umber eyes and transforms into a [Spell Name] before you...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Flexing his fingers slightly, Xanlin&#039;s form begins to darken and shadows seep from his umber eyes.  Xanlin releases his spell by transforming that darkness around him into a spiritual shield.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Darkness briefly pools about the area.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  202&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a thin shadowy black parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athinshadowyblackparchment&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athinshadowyblackparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Tenebrous shadows slip across your sun-kissed, lightly freckled skin as you demand divinity to heed your prayers.  As if in answer, a darkness falls across your vision and you release your [Spell Name]...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Tenebrous shadows slip across Xanlin&#039;s sun-kissed, lightly freckled skin as he demands divinity to heed his prayers.  As if in answer, his umber eyes briefly blacken as he releases his fury.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  317&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the decaying oaken slab you see:||contents= a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a coin-edged piece of sheet music || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acoin-edgedpieceofsheetmusic&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acoin-edgedpieceofsheetmusic&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Humming a familiar ditty about a knave found on the wrong side of a door, Xanlin weaves the simple somatic components of a spell into the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  Rising on the air is a familiar ditty.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  403&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a sheet of watermarked music || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asheetofwatermarkedmusic&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asheetofwatermarkedmusic&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals.  As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Lifting his voice in song, Xanlin spins a quick tale involving a small child trying to discover the mysteries of water elementals.  As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:  A simple song about a small child trying to discover the mysteries of water elementals rises on the air.&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  405&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a violet cotton sheet || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avioletcottonsheet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avioletcottonsheet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Tracing simple lines upon your sun-kissed, lightly freckled brow, you invoke the elements and implore them to give you deeper insight.  Within seconds, a third umber eye opens in your forehead as you cast the [Spell Name] spell.  The eye fades in a matter of moments...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Tracing simple lines upon his sun-kissed, lightly freckled brow, Xanlin invokes the elements and almost instantly a third umber eye opens in his forehead.  Seconds after he releases the spell, the eye fades away.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  416&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a soft sigil-etched sheet || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asoftsigil-etchedsheet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asoftsigil-etchedsheet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Tracing sigils in the air, each briefly illuminating in various brilliant hues, Xanlin invokes the elements as he casts his spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  419&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a whorl-edged cloud white note || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awhorl-edgedcloudwhitenote&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awhorl-edgedcloudwhitenote&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;&lt;br /&gt;
It will provide the following phrase:&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;First Person:  Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud.  Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...&amp;lt;br&amp;gt;&lt;br /&gt;
Third Person:  Drawing his fingers through the air, Xanlin&#039;s movements gradually become sluggish as he finishes the somatic components of his spell.&amp;lt;br&amp;gt;&lt;br /&gt;
Hidden or Invisible:&amp;lt;br&amp;gt;&lt;br /&gt;
Specific Spell Restriction:  504&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2020Q3 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Previous Inventory==&lt;br /&gt;
&amp;lt;section begin=current /&amp;gt;&lt;br /&gt;
==Spellbound==&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Spellbound&lt;br /&gt;
|look=a narrow space between two buildings&lt;br /&gt;
|location=Map Room 16, Lich #26878, go narrow space&lt;br /&gt;
|year=2020&lt;br /&gt;
|letter=S&lt;br /&gt;
}}&lt;br /&gt;
&amp;lt;!--==={{{ [Spellbound] 26878 2020-02-13 13:48:08 -0600}}}===--&amp;gt;===Spellbound===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Spellbound - 26878&lt;br /&gt;
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else.  A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall.  Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate.&lt;br /&gt;
|exits= south, out}}&lt;br /&gt;
{{sign|margin-right=40%&lt;br /&gt;
|sign=Spell preps!&lt;br /&gt;
In crate: Circles 100-400&lt;br /&gt;
Behind brick: Circles 500-900&lt;br /&gt;
On brick: Circles 1000-1700, and ALL casting&lt;br /&gt;
Please READ each paper to see specific restrictions.&lt;br /&gt;
The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, a certificate to increase its maximum charges by 1, and a ticket to add 1 appearance set.  Each charge lasts 1 month, and the trinket can be recharged by monks and recharging merchants.&lt;br /&gt;
Items in the case are magical trinkets which automatically recharge daily:&lt;br /&gt;
Deathstone Pin: Spirit Strike (117) - 2x/day&lt;br /&gt;
Heroic Knight Clasp: Heroism (215) - 1x/day&lt;br /&gt;
Green Leaf Symbol: Phoen&#039;s Strength (606) - 1x/day&lt;br /&gt;
Sickly Green Sigil: Pestilence (716) - 3x/day&lt;br /&gt;
Green Wavy Symbol: Mass Blur (911) - 1x/day&lt;br /&gt;
Yellow Smooth Cylinder: Arm of the Arkati (1605) - 1x/day&lt;br /&gt;
Wrapped Hand Symbol: Brace (1214) - 1x/day&lt;br /&gt;
Dark Purple Amethyst Pendant: Empathic Focus (1109) - 1x/day&lt;br /&gt;
&lt;br /&gt;
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer&#039;s preferred deity.&lt;br /&gt;
&lt;br /&gt;
New potions on the shelf!&lt;br /&gt;
The wispy orange brew significantly increases one&#039;s enchanting skill and comes with 1 dose (old style Enchanting only!).  &lt;br /&gt;
The viscous opalescent brew significantly increases one&#039;s enchanting skill and comes with 5 doses (new style Enchanting only!).  &lt;br /&gt;
The draught significantly increases one&#039;s ensorcelling skill and comes with 1 dose.  &lt;br /&gt;
Lastly, the bromin (8x), aleteh (9x), and grenshol (10x) potions are for pretempering to enchant items to much higher than normal levels (8-10x).}}&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the sigil-incised display case you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a black deathstone pin || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablackdeathstonepin&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablackdeathstonepin&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Spirit Strike]]&amp;lt;br&amp;gt;2 charges&amp;lt;br&amp;gt;rubbing activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10000&lt;br /&gt;
|-&lt;br /&gt;
| a heroic knight clasp || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheroicknightclasp&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheroicknightclasp&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Heroism]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;raising activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 20000&lt;br /&gt;
|-&lt;br /&gt;
| a green leaf symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agreenleafsymbol&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agreenleafsymbol&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Phoen&#039;s Strength]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;raising activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 15000&lt;br /&gt;
|-&lt;br /&gt;
| a sickly green sigil || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asicklygreensigil&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asicklygreensigil&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Pestilence]]&amp;lt;br&amp;gt;3 charges&amp;lt;br&amp;gt;raising activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10000&lt;br /&gt;
|-&lt;br /&gt;
| a green wavy symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agreenwavysymbol&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agreenwavysymbol&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Mass Blur]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;raising activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10000&lt;br /&gt;
|-&lt;br /&gt;
| a yellow smooth cylinder || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ayellowsmoothcylinder&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ayellowsmoothcylinder&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Arm of the Arkati]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;raising activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 10000&lt;br /&gt;
|-&lt;br /&gt;
| a small wrapped hand symbol || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmallwrappedhandsymbol&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmallwrappedhandsymbol&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Brace]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;raising activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 20000&lt;br /&gt;
|-&lt;br /&gt;
| a dark purple amethyst pendant || Weight: &amp;lt;1 pound || pin-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adarkpurpleamethystpendant&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, imbed&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adarkpurpleamethystpendant&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This is a magical item that has some special properties.  Casting Elemental Detection (spell 405) will offer more information.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;[[Magic Item Use|Imbed]]:&#039;&#039;&#039;&amp;lt;br&amp;gt;[[Empathic Focus]]&amp;lt;br&amp;gt;1 charge&amp;lt;br&amp;gt;raising activated&amp;lt;br&amp;gt;persists&amp;lt;/div&amp;gt;&lt;br /&gt;
| 100000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=Under the sigil-incised display case you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a blackened silver necklace set with an orb-caged white pearl || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25000&lt;br /&gt;
|-&lt;br /&gt;
| an oval-linked electrum necklace set with a cylinder-caged crimson blazestar || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;The necklace is made from a perfectly spherical star ruby.  The crimson stone is a dark shade of red-black, reflecting Tilaok&#039;s current new moon phase.  Even the stone&#039;s star is dim.  An elegant setting of pure platinum holds the miniature moon.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25000&lt;br /&gt;
|-&lt;br /&gt;
| a slender vaalin necklace set with a square-caged silver starstone || Weight: &amp;lt;1 pound || neck-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This necklace was originally released during the auction of 5100.  Current verbs are LOOK and SHOW.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;The necklace is made from a perfect sphere of polished moonstone.  The silvery stone is a dark shade of grey, reflecting Liabo&#039;s current new moon phase.  A delicate setting of pure platinum holds the miniature moon.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 25000&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the rune-covered wooden crate you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a jewel-toned striped paper || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ajewel-tonedstripedpaper&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ajewel-tonedstripedpaper&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this striped paper will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Grating out a request to the nearby spirits, you leech upon their power for [Spell Name], your veins light up with a dim luminescence.&amp;lt;br&amp;gt;Third Person:  Grating out an incomprehensible phrase, Player&#039;s eyes flash with power, his veins lighting up with a dim luminescence.&amp;lt;br&amp;gt;Hidden or Invisible:  A dim luminescence glows briefly in the shape of a figure, then disappears.&amp;lt;br&amp;gt;Specific Spell Restriction:  103&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a finely scripted palimpsest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afinelyscriptedpalimpsest&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afinelyscriptedpalimpsest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this scripted palimpsest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Murmuring an incantation for [Spell Name], you momentarily feel as if you are flying through the stars, darkness pressing in on you.&amp;lt;br&amp;gt;Third Person:  Player&#039;s eyelids flicker rapidly and a star-pricked darkness flows across his skin as he murmurs a magical incantation.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear soft murmuring.&amp;lt;br&amp;gt;Specific Spell Restriction:  116&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a sun-embossed golden parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asun-embossedgoldenparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asun-embossedgoldenparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this golden parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Tendrils of darksome mist gather about you, swirling upwards, as you beseech the lesser spirits for aid with the [Spell Name] spell...&amp;lt;br&amp;gt;Third Person:  Tendrils of darksome mist gather about Player, swirling upwards as he beseeches the lesser spirits for aid...&amp;lt;br&amp;gt;Hidden or Invisible:  You hear someone beseeching the lesser spirits for aid.&amp;lt;br&amp;gt;Specific Spell Restriction:  125&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a silver-inked ebon paper || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilver-inkedebonpaper&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilver-inkedebonpaper&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this ebon paper will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Motes of pearly light dance across your fingers and splay out around you as you quietly, lullingly, whisper the incantation for [Spell Name].&amp;lt;br&amp;gt;Third Person:  While Player whispers quietly, lullingly, motes of pearly light dance across his fingers and splay out around him.&amp;lt;br&amp;gt;Hidden or Invisible:  Motes of pearly light dance through the air as quiet, lulling whispering floats through the area.&amp;lt;br&amp;gt;Specific Spell Restriction:  202&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a creased powder blue palimpsest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acreasedpowderbluepalimpsest&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acreasedpowderbluepalimpsest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this powder blue palimpsest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Preparing [Spell Name], you solicit the spirits with a casual flick of the hand, and tendrils of sanguine thread appear, then wrap around your hand in an agonizingly painful bind before they fade away.&amp;lt;br&amp;gt;Third Person:  Player casually flicks his hand, tendrils of sanguine thread appearing and then wrapping tightly around it before they fade away.&amp;lt;br&amp;gt;Hidden or Invisible:  Tendrils of sanguine threading appear in the air, then move in an odd but clearly regular pattern before fading away.&amp;lt;br&amp;gt;Specific Spell Restriction:  214&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a heart-stamped bright salmon paper || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheart-stampedbrightsalmonpaper&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheart-stampedbrightsalmonpaper&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this bright salmon paper will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  As you gaze off into the distance, concentrating on the thought of a simple litany for [Spell Name], gently flowing wisps of mist rise up and circle around you.&amp;lt;br&amp;gt;Third Person:  Player gazes off into the distance, and gently flowing wisps of mist rise up and circle around him.&amp;lt;br&amp;gt;Hidden or Invisible:  Gently flowing wisps of mist rise up and float in a circular motion.&amp;lt;br&amp;gt;Specific Spell Restriction:  303&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a midnight blue-starred parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amidnightblue-starredparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amidnightblue-starredparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this blue-starred parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Platinum energy streaks through your body, your veins and eyes glowing brightly as you growl a violent prayer for [Spell Name].&amp;lt;br&amp;gt;Third Person:  Platinum energy streaks through Player&#039;s body, his veins and eyes glowing brightly as he growls a violent prayer.&amp;lt;br&amp;gt;Hidden or Invisible:  Platinum energy streaks through the air in an odd pattern as a violent prayer pierces the air.&amp;lt;br&amp;gt;Specific Spell Restriction:  317&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a hideous lumpy brown scroll || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ahideouslumpybrownscroll&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ahideouslumpybrownscroll&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this lumpy brown scroll will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  As you gesture precise movements for the [Spell Name] spell, your fingers transform into elongated objects before returning to their original shape...&amp;lt;br&amp;gt;Third Person:  Player gestures precise movements, and for a moment, his fingers transform into elongated objects.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  403&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an ale-stained half-bound scroll || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anale-stainedhalf-boundscroll&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anale-stainedhalf-boundscroll&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this half-bound scroll will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Murmuring a soothing invocation for [Spell Name], bright arcs of elemental energy spark around you as you pull on their power.&amp;lt;br&amp;gt;Third Person:  Murmuring a soothing invocation, bright arcs of elemental energy spark around Player.&amp;lt;br&amp;gt;Hidden or Invisible:  Bright arcs of elemental energy spark through the air.&amp;lt;br&amp;gt;Specific Spell Restriction:  405&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a wide-striped blue and gold palimpsest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awide-stripedblueandgoldpalimpsest&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awide-stripedblueandgoldpalimpsest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this blue and gold palimpsest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  You close your eyes and twin beams of violet light issue from your illuminated eye sockets as you invoke the powers of the elements for the [Spell Name] spell...&amp;lt;br&amp;gt;Third Person:  Player closes his eyes and twin beams of violet light issue from his illuminated eye sockets as he invokes the powers of the elements.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear someone invoking the powers of the elements.&amp;lt;br&amp;gt;Specific Spell Restriction:  416&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an ink-blotted coppery papyrus || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anink-blottedcopperypapyrus&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anink-blottedcopperypapyrus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this coppery papyrus will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  You draw an abstruse sigil for [Spell Name] in the air with your fingers, and brilliant light swirls up out of your pores.&amp;lt;br&amp;gt;Third Person:  Player draws an abstruse sigil in the air with his fingers, and brilliant light swirls up out of his pores.&amp;lt;br&amp;gt;Hidden or Invisible:  Brilliant light swirls around the area.&amp;lt;br&amp;gt;Specific Spell Restriction:  419&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the brick you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a frayed-edge ivory vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afrayed-edgeivoryvellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afrayed-edgeivoryvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this ivory vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Breaking into a tortured song for [Spell Name], you focus on crafting a tune rife with loathing and distress.&amp;lt;br&amp;gt;Third Person:  Player breaks into a tortured song, crafting a tune rife with loathing and distress.&amp;lt;br&amp;gt;Hidden or Invisible:  A tortured song drifts through the area, its tune rife with loathing and distress.&amp;lt;br&amp;gt;Specific Spell Restriction:  1001&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a hastily scrawled papyrus || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ahastilyscrawledpapyrus&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ahastilyscrawledpapyrus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this scrawled papyrus will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Drawing in a long breath to prepare [Spell Name], you eke out an off-key melody fit for shattering glass, and a sharp pain stabs your mind.&amp;lt;br&amp;gt;Third Person:  Player draws in a long breath, his expression suddenly pained as he ekes out an off-key melody fit for shattering glass.&amp;lt;br&amp;gt;Hidden or Invisible:  An off-key melody fit for shattering glass fills the air.&amp;lt;br&amp;gt;Specific Spell Restriction:  1019&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an onyx-dusted pristine white palimpsest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anonyx-dustedpristinewhitepalimpsest&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anonyx-dustedpristinewhitepalimpsest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this pristine white palimpsest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  You close your eyes and focus on [Spell Name], envPlayering how your limbs&#039; anatomical structure -- the tendons, muscles, bones, blood vessels -- all work together in perfect harmony.&amp;lt;br&amp;gt;Third Person:  Player closes his eyes, and the skin on his limbs briefly fades to translucency, the anatomical structure -- the tendons, muscles, bones, blood vessels -- visible for a mere moment.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  1102&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a wax-crusted pale violet scroll || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awax-crustedpalevioletscroll&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awax-crustedpalevioletscroll&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this pale violet scroll will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  As you raise your hands up to prepare the [Spell Name] spell and insistently beckon several spirits to you, the faint outlines of their caliginous shadows flutter in and out of sight.&amp;lt;br&amp;gt;Third Person:  The faint outlines of caliginous shadows flutter in and out of sight around Player as he raises his hands in an insistently beckoning manner.&amp;lt;br&amp;gt;Hidden or Invisible:  The faint outlines of caliginous shadows flutter in and out of sight.&amp;lt;br&amp;gt;Specific Spell Restriction:  1115&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a beige flower-pressed vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abeigeflower-pressedvellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abeigeflower-pressedvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this flower-pressed vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Crooning the [Spell Name] spell in an archaic tongue, you focus on the passage of time, quickly shuttering the past and the present away.&amp;lt;br&amp;gt;Third Person:  As Player croons an archaic phrase, he stares off into the distance, his eyes briefly turning to pools of marbled argent.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear soft crooning sounds.&amp;lt;br&amp;gt;Specific Spell Restriction:  1204&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This vellum looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a mossy green folded parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amossygreenfoldedparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amossygreenfoldedparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this green folded parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Clearing your mind of all but the [Spell Name] spell, you touch the tips of your fingers together and focus on the single thought of terrible pain slicing outward from them.&amp;lt;br&amp;gt;Third Person:  Player touches the tips of his fingers together, a cruel expression flitting across his features.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  1210&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a stained tart-stamped scroll || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-astainedtart-stampedscroll&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-astainedtart-stampedscroll&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this tart-stamped scroll will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Calling forth the [Spell Name] spell with the intonation of a single syllable, a murky shroud peels away from you and vanishes.&amp;lt;br&amp;gt;Third Person:  As Player intones a spell with a single syllable, a murky shroud peels away from him and vanishes.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear a single intoned syllable.&amp;lt;br&amp;gt;Specific Spell Restriction:  1606&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an iridescent tangerine papyrus || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aniridescenttangerinepapyrus&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aniridescenttangerinepapyrus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this tangerine papyrus will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Waves of argentine light curl around you, embracing and seeping into you as you call upon your patron for [Spell Name].&amp;lt;br&amp;gt;Third Person:  Waves of argentine light curl around Player, embracing and seeping into him as he calls upon his patron.&amp;lt;br&amp;gt;Hidden or Invisible:  Waves of argentine light appear to curl through the air until they disappear.&amp;lt;br&amp;gt;Specific Spell Restriction:  1615&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an embossed clover green vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anembossedclovergreenvellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anembossedclovergreenvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this clover green vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  A haze of noxious vapor forms in the air overhead as you recite the esoteric command for [Spell Name]...&amp;lt;br&amp;gt;Third Person:  A haze of noxious vapor forms in the air overhead as Player recites an esoteric command.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear someone reciting an esoteric command.&amp;lt;br&amp;gt;Specific Spell Restriction:  109&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a translucent alabaster vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-atranslucentalabastervellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-atranslucentalabastervellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this alabaster vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  A haze of black mist gathers around you as you prepare [Spell Name]...&amp;lt;br&amp;gt;Third Person:  A haze of black mist gathers around Player as he prepares a spell...&amp;lt;br&amp;gt;Hidden or Invisible:  A haze of black mist appears and slowly dissipates.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a cat paw-printed paper || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acatpaw-printedpaper&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acatpaw-printedpaper&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this paw-printed paper will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Wisps of crimson light materialize in your palms, slowly floating into the air and disappearing as you chant the phrase for [Spell Name]...&amp;lt;br&amp;gt;Third Person:  Wisps of crimson light materialize in Player&#039;s palms, slowly floating into the air and disappearing as he chants a phrase...&amp;lt;br&amp;gt;Hidden or Invisible:  Wisps of crimson light float into the air.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=Behind the brick you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a wavy-edged azure vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awavy-edgedazurevellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awavy-edgedazurevellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this azure vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Swiping your hand emphatically through the air, you deliberately slow its motion as you finish the stylized gesture for the [Spell Name] spell.&amp;lt;br&amp;gt;Third Person:  Player swipes his hand emphatically through the air, his motion slowing significantly as he finishes the stylized gesture.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  504&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a gold-inked dark burgundy parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agold-inkeddarkburgundyparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agold-inkeddarkburgundyparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this dark burgundy parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Barking an order at the ground below you to prepare the [Spell Name] spell, you feel it respond with a light tremble that sends a jolt of elemental energy racing through you.&amp;lt;br&amp;gt;Third Person:  Player barks an order at the ground below him, and it trembles lightly in response.&amp;lt;br&amp;gt;Hidden or Invisible:  The ground trembles lightly.&amp;lt;br&amp;gt;Specific Spell Restriction:  514&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a leaf-shaped pale green paper || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aleaf-shapedpalegreenpaper&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aleaf-shapedpalegreenpaper&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this pale green paper will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  You envPlayer a forest growing up around you, evergreen trees bending down toward you to listen to your incantation of [Spell Name].&amp;lt;br&amp;gt;Third Person:  For just a moment, Player appears to be surrounded by evergreen trees bending toward him to listen to his magical incantation.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  605&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a neat aquamarine papyrus || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aneataquamarinepapyrus&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aneataquamarinepapyrus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this aquamarine papyrus will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  As you quickly call forth the [Spell Name] spell, variegated pale turquoise light encompasses your hands.&amp;lt;br&amp;gt;Third Person:  As Player chants a magical phrase, variegated pale turquoise light encompasses his hands.&amp;lt;br&amp;gt;Hidden or Invisible:  Variegated pale turquoise light briefly lights up the area.&amp;lt;br&amp;gt;Specific Spell Restriction:  619&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a simple light grey scroll || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asimplelightgreyscroll&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asimplelightgreyscroll&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this light grey scroll will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Your body flushes with a blood red hue, your veins standing out from your skin, as you incant a mantra for [Spell Name].&amp;lt;br&amp;gt;Third Person:  Player&#039;s body flushes a blood red hue, his veins standing out from his skin and twisting his features, as he incants a mantra.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear a quiet incantation.&amp;lt;br&amp;gt;Specific Spell Restriction:  701&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a neatily creased parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aneatilycreasedparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aneatilycreasedparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this creased parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  The flesh of your fingers blackens as you breathe in deeply, blood seeping out around your knuckles, then returns to normal as you focus on preparing [Spell Name].&amp;lt;br&amp;gt;Third Person:  The flesh of Player&#039;s fingers blackens, blood seeping out around his knuckles as he breathes in deeply, then returns to normal.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  712&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a blue-inked deep tan papyrus || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablue-inkeddeeptanpapyrus&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablue-inkeddeeptanpapyrus&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this deep tan papyrus will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  The whites of your eyes glow a luminous green around the black depths of your pupils as you forcefully invoke [Spell Name]...&amp;lt;br&amp;gt;Third Person:  The whites of Player&#039;s eyes glow a luminous green around the black depths of his pupils as he forcefully invokes a spell.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear someone forcefully invoking a spell.&amp;lt;br&amp;gt;Specific Spell Restriction:  713&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a ragged and stained paper || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-araggedandstainedpaper&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-araggedandstainedpaper&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this stained paper will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Your eyes roll back into your head and your body heaves spasmodically as the invocation of the [Spell Name] spell issues from the rictus of your gaping mouth...&amp;lt;br&amp;gt;Third Person:  Player&#039;s eyes roll back into his head and his body heaves spasmodically as an invocation issues from his gaping mouth.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear someone invoking a spell.&amp;lt;br&amp;gt;Specific Spell Restriction:  725&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a scalloped light yellow vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ascallopedlightyellowvellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ascallopedlightyellowvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this light yellow vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  You feel energy ripple around you in chaotic waves, and you yank it toward you as you prepare the [Spell Name] spell.&amp;lt;br&amp;gt;Third Person:  Player&#039;s eyes darken, then glow with chaotically shifting light, as he chants a magical phrase.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear someone chant a magical phrase.&amp;lt;br&amp;gt;Specific Spell Restriction:  905&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a rolled and stamped palimpsest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-arolledandstampedpalimpsest&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-arolledandstampedpalimpsest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this stamped palimpsest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  As you draw heated power from the earth for the [Spell Name] spell, bits of flesh flake off of your skin, rising up into the air and turning to brightly burning cinders that whirl around you.&amp;lt;br&amp;gt;Third Person:  Bits of flesh flake off of Player&#039;s skin, rising up into the air and turning to brightly burning cinders that whirl around him.&amp;lt;br&amp;gt;Hidden or Invisible:  Brightly burning cinders whirl through the air.&amp;lt;br&amp;gt;Specific Spell Restriction:  917&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a soot-dusted yellowing parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asoot-dustedyellowingparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asoot-dustedyellowingparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this yellowing parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  A great mass of turbulent air roils before you as you invoke the phrase for [Spell Name]...&amp;lt;br&amp;gt;Third Person:  A great mass of turbulent air roils before Player as he invokes a magical phrase.&amp;lt;br&amp;gt;Hidden or Invisible:  You hear someone invoking a magical phrase.&amp;lt;br&amp;gt;Specific Spell Restriction:  912&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the small round table you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a violet-tinted electrum monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aviolet-tintedelectrummonocle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aviolet-tintedelectrummonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
| a reflective gold-rimmed monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-areflectivegold-rimmedmonocle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-areflectivegold-rimmedmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
| a bent-framed brass monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abent-framedbrassmonocle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abent-framedbrassmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
| a heavy invar monocle || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavyinvarmonocle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavyinvarmonocle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person&#039;s deity.&amp;lt;br&amp;gt;This ability can be blocked by unpresence.  If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity&#039;s symbol in the monocle&#039;s lens.&amp;lt;br&amp;gt;USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]&amp;lt;br&amp;gt;Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear&amp;lt;br&amp;gt;Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line.  If it is not toggled, then it will show normally in the inventory line.&amp;lt;br&amp;gt;Currently, the monocle is not toggled and will be worn normally.&amp;lt;br&amp;gt;This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the dilapidated wooden shelf you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a viscous opalescent brew || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aviscousopalescentbrew&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aviscousopalescentbrew&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew.  A bard may be able to provide more specifics.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50000&lt;br /&gt;
|-&lt;br /&gt;
| a grenshol potion || Weight: 2 pounds || || &lt;br /&gt;
| 30000&lt;br /&gt;
|-&lt;br /&gt;
| an aleteh potion || Weight: 2 pounds || || &lt;br /&gt;
| 25000&lt;br /&gt;
|-&lt;br /&gt;
| a bromin potion || Weight: 2 pounds || || &lt;br /&gt;
| 20000&lt;br /&gt;
|-&lt;br /&gt;
| a wispy orange brew || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awispyorangebrew&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awispyorangebrew&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew.  A bard may be able to provide more specifics.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50000&lt;br /&gt;
|-&lt;br /&gt;
| a shimmering trinket || Weight: &amp;lt;1 pound || pin-worn&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashimmeringtrinket&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashimmeringtrinket&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;The shimmering trinket is a &amp;quot;Shimmer Trinket&amp;quot;, which can store the appearance of wearable items and project them over your normal clothing when it&#039;s worn.  Just wear whatever items you want in whatever order you desire, then ATTEND the trinket.  Once worn, it will only display those items while concealing all others.  You may also CLEAN it to remove the previously stored appearance.  If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on.  TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description).  PUSH will rotate between the available appearance sets.&amp;lt;br&amp;gt;It is not currently active, but is using set 1 (out of 1): nothing special at this time.&amp;lt;br&amp;gt;The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants.  A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.&amp;lt;br&amp;gt;You can tell that the trinket is as light as it can get.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 5000&lt;br /&gt;
|-&lt;br /&gt;
| a bubbling bright green draught || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abubblingbrightgreendraught&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abubblingbrightgreendraught&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught.  A bard may be able to provide more specifics.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 50000&lt;br /&gt;
|-&lt;br /&gt;
| a dog-eared brown suede tome || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adog-earedbrownsuedetome&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adog-earedbrownsuedetome&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This brown suede tome is a heavily scripted fluff book.  It can be altered freely so long as it remains a book.&amp;lt;br&amp;gt;Traps:  CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE&amp;lt;br&amp;gt;TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.&amp;lt;br&amp;gt;Try as you might, you cannot get a good sense of whether or not the tome&#039;s pockets could get any deeper, but you can tell that the tome is as light as it can get.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2000&lt;br /&gt;
|-&lt;br /&gt;
| an immaculate white leather codex || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-animmaculatewhiteleathercodex&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-animmaculatewhiteleathercodex&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This white leather codex is a heavily scripted fluff book.  It can be altered freely so long as it remains a book.&amp;lt;br&amp;gt;Traps:  CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE&amp;lt;br&amp;gt;TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.&amp;lt;br&amp;gt;Try as you might, you cannot get a good sense of whether or not the codex&#039;s pockets could get any deeper, but you can tell that the codex is as light as it can get.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 2000&lt;br /&gt;
|-&lt;br /&gt;
| a bulbous vibrant crimson bottle || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abulbousvibrantcrimsonbottle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abulbousvibrantcrimsonbottle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This vibrant crimson bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.&amp;lt;br&amp;gt;Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.&amp;lt;br&amp;gt;It can hold a maximum of 50 items.  PUT items in to store them.  SHAKE the bottle to get them back out.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 100&lt;br /&gt;
|-&lt;br /&gt;
| a gold-caged lustrous green jar || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agold-cagedlustrousgreenjar&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agold-cagedlustrousgreenjar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This lustrous green jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.&amp;lt;br&amp;gt;Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.&amp;lt;br&amp;gt;It can hold a maximum of 50 items.  PUT items in to store them.  SHAKE the jar to get them back out.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 100&lt;br /&gt;
|-&lt;br /&gt;
| a silver-chased dark purple bottle || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilver-chaseddarkpurplebottle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilver-chaseddarkpurplebottle&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This dark purple bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.&amp;lt;br&amp;gt;Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.&amp;lt;br&amp;gt;It can hold a maximum of 100 items.  PUT items in to store them.  SHAKE the bottle to get them back out.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a squat pale pink jar || Weight: &amp;lt;1 pound &amp;lt;br&amp;gt;Pocketed: Very small (&amp;lt;2-4)&amp;lt;br&amp;gt;one item|| &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asquatpalepinkjar&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asquatpalepinkjar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This pale pink jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.&amp;lt;br&amp;gt;Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.&amp;lt;br&amp;gt;It can hold a maximum of 100 items.  PUT items in to store them.  SHAKE the jar to get them back out.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 250&lt;br /&gt;
|-&lt;br /&gt;
| a shimmering certificate || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashimmeringcertificate&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashimmeringcertificate&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Your certificate is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.&amp;lt;br&amp;gt;You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;Your certificate may not be altered or changed in any way.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;As you glance over the certificate you notice something written on it...&amp;lt;br&amp;gt;This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1000&lt;br /&gt;
|-&lt;br /&gt;
| a glittering ticket || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aglitteringticket&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aglitteringticket&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Your ticket is used to unlock the potential of things held in your other hand.&amp;lt;br&amp;gt;The glittering ticket will add 1 appearance set to an existing Shimmer Trinket.  No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).&amp;lt;br&amp;gt;You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.&amp;lt;br&amp;gt;Your ticket may not be altered or changed in any way.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;As you glance over the ticket you notice something written on it...&amp;lt;br&amp;gt;This glittering ticket will add 1 appearance set to an existing Shimmer Trinket.  No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100.  i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).&amp;lt;/div&amp;gt;&lt;br /&gt;
| 3500&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- additional room --&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=Spellbound, Crevice&lt;br /&gt;
|look=crevice&lt;br /&gt;
|location=Lich# 26878, south&lt;br /&gt;
|year=2020&lt;br /&gt;
|letter=S&lt;br /&gt;
}}&lt;br /&gt;
&amp;lt;!--==={{{ [Spellbound, Crevice] 26881 2020-02-13 13:36:29 -0600}}}===--&amp;gt;===Spellbound, Crevice===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=Spellbound, Crevice - 26881&lt;br /&gt;
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall.  Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. &lt;br /&gt;
|exits= north}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the dilapidated birch shelf you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a smooth off-white vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmoothoff-whitevellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmoothoff-whitevellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures.  Your blue-grey eyes flash with a holy light as you release the [Spell Name] spell...&amp;lt;br&amp;gt;Third Person:  Cajoling the lesser spirits, Player utters a lyrical prayer that is accompanied by simple gestures.  His blue-grey eyes flash with a holy light as he releases his spell.&amp;lt;br&amp;gt;Hidden or Invisible:  From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.&amp;lt;br&amp;gt;Specific Spell Restriction:  103&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a translucent cream-hued vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-atranslucentcream-huedvellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-atranslucentcream-huedvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Closing your eyes tightly, you concentrate on an image within your mind&#039;s eye and murmur a soft prayer to the spirits.  As the last syllable falls from your lips, your blue-grey eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...&amp;lt;br&amp;gt;Third Person:  Closing his eyes tightly, Player appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits.  As the last syllable falls from his lips, his blue-grey eyes fly wide open and he flicks his fingers, releasing his spell.&amp;lt;br&amp;gt;Hidden or Invisible:  Blue-grey light suddenly flashes in the air.&amp;lt;br&amp;gt;Specific Spell Restriction:  116&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a silvery lightning-motif vellum || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilverylightning-motifvellum&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilverylightning-motifvellum&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will.  Zorchar energy crackles across the surface of your fair skin as you release the stored energy of the [Spell Name] spell...&amp;lt;br&amp;gt;Third Person:  Curling his fingers into claws, Player forcefully confronts the spirits and demands that they mold themselves to his will.  Zorchar energy crackles across the surface of his fair skin as he releases the stored energy of his spell.&amp;lt;br&amp;gt;Hidden or Invisible:  Zorchar energy crackles through the air.&amp;lt;br&amp;gt;Specific Spell Restriction:  125&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a small scale-shaped parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmallscale-shapedparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmallscale-shapedparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...&amp;lt;br&amp;gt;Third Person:  Sibilantly forming the simple words of his prayer, Player implores shadows and darkness to protect him.&amp;lt;br&amp;gt;Hidden or Invisible:  Sibilant prayers issue from the darkness.&amp;lt;br&amp;gt;Specific Spell Restriction:  303&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| an inky black palimpest || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aninkyblackpalimpest&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aninkyblackpalimpest&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond.  Slowly, darkness seeps from your blue-grey eyes and transforms into a [Spell Name] before you...&amp;lt;br&amp;gt;Third Person:  Flexing his fingers slightly, Player&#039;s form begins to darken and shadows seep from his blue-grey eyes.  Player releases his spell by transforming that darkness around him into a spiritual shield.&amp;lt;br&amp;gt;Hidden or Invisible:  Darkness briefly pools about the area.&amp;lt;br&amp;gt;Specific Spell Restriction:  202&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a thin shadowy black parchment || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athinshadowyblackparchment&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athinshadowyblackparchment&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Tenebrous shadows slip across your fair skin as you demand divinity to heed your prayers.  As if in answer, a darkness falls across your vPlayer and you release your [Spell Name]...&amp;lt;br&amp;gt;Third Person:  Tenebrous shadows slip across Player&#039;s fair skin as he demands divinity to heed his prayers.  As if in answer, his blue-grey eyes briefly blacken as he releases his fury.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  317&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the decaying oaken slab you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a coin-edged piece of sheet music || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acoin-edgedpieceofsheetmusic&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acoin-edgedpieceofsheetmusic&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...&amp;lt;br&amp;gt;Third Person:  Humming a familiar ditty about a knave found on the wrong side of a door, Player weaves the simple somatic components of a spell into the air.&amp;lt;br&amp;gt;Hidden or Invisible:  Rising on the air is a familiar ditty.&amp;lt;br&amp;gt;Specific Spell Restriction:  403&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a sheet of watermarked music || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asheetofwatermarkedmusic&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asheetofwatermarkedmusic&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals.  As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...&amp;lt;br&amp;gt;Third Person:  Lifting his voice in song, Player spins a quick tale involving a small child trying to discover the mysteries of water elementals.  As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.&amp;lt;br&amp;gt;Hidden or Invisible:  A simple song about a small child trying to discover the mysteries of water elementals rises on the air.&amp;lt;br&amp;gt;Specific Spell Restriction:  405&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a violet cotton sheet || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avioletcottonsheet&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avioletcottonsheet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Tracing simple lines upon your fair brow, you invoke the elements and implore them to give you deeper insight.  Within seconds, a third blue-grey eye opens in your forehead as you cast the [Spell Name] spell.  The eye fades in a matter of moments...&amp;lt;br&amp;gt;Third Person:  Tracing simple lines upon his fair brow, Player invokes the elements and almost instantly a third blue-grey eye opens in his forehead.  Seconds after he releases the spell, the eye fades away.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  416&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a soft sigil-etched sheet || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asoftsigil-etchedsheet&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asoftsigil-etchedsheet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...&amp;lt;br&amp;gt;Third Person:  Tracing sigils in the air, each briefly illuminating in various brilliant hues, Player invokes the elements as he casts his spell.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  419&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
| a whorl-edged cloud white note || Weight: &amp;lt;1 pound || &lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awhorl-edgedcloudwhitenote&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, show description&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awhorl-edgedcloudwhitenote&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.&amp;lt;br&amp;gt;It will provide the following phrase:&amp;lt;br&amp;gt;First Person:  Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud.  Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...&amp;lt;br&amp;gt;Third Person:  Drawing his fingers through the air, Player&#039;s movements gradually become sluggish as he finishes the somatic components of his spell.&amp;lt;br&amp;gt;Hidden or Invisible:&amp;lt;br&amp;gt;Specific Spell Restriction:  504&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;&#039;&#039;&#039;Show:&#039;&#039;&#039;&amp;lt;br&amp;gt;This paper looks interesting... perhaps you should read it.&amp;lt;/div&amp;gt;&lt;br /&gt;
| 750&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=current /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
{{#section:BVShop:Spellbound/archive|archive}}&lt;br /&gt;
{{top}}&lt;br /&gt;
[[Category: Bloodriven Village Shops|S]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=BVShop:The_Cover_Up&amp;diff=144552</id>
		<title>BVShop:The Cover Up</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=BVShop:The_Cover_Up&amp;diff=144552"/>
		<updated>2021-02-13T14:44:25Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: moved information from separate page into this one to fix wiki page&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;==Current Inventory==&lt;br /&gt;
&amp;lt;section begin=2021Q1 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=a narrow building at the end of the wall&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=Map Room 3, Lich# 26857, go building&lt;br /&gt;
|fest=dr|year=2021|letter=C}}&lt;br /&gt;
===The Cover Up, Men&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Men&#039;s Room] 23751 2021-02-13 01:56:59 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Men&#039;s Room - 23751&lt;br /&gt;
|desc=Dark and reflective, the surrounding walls are covered in smooth ebony planks that have been secured with silver-headed nails.  A marble-topped iron stand with a small crystal bowl flanks one side of the entrance, and a pair of well-dressed mannequins have been situated in front of a tri-mirrored wall, giving the illusion of a much larger collection of display models.  Sheer black lace hangs over a doorway leading to the back of the shop.&lt;br /&gt;
|exits= out}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the iron stand you see:||contents=&amp;lt;br&amp;gt;&amp;lt;b&amp;gt;Containers [1]:&amp;lt;/b&amp;gt; a crystal bowl}}&lt;br /&gt;
{{Container2||container=In the bowl you see:||contents= some star-shaped mint chocolate.}}&lt;br /&gt;
{{Container2||container=On the short male mannequin you see:||contents= a faded ebon leather vestment beaded in pale bone, a layered shroud of well-brushed wolf pelts, a dark leather duster branded in skeletal designs, a heavy ashen suede robe hung in various bone fetishes, a charcoal felted wool overcoat with long buckskin lapels, a shaggy bear fur coat covered in a myriad of buckles and a leaf-branded pale leather cloak shaded in gradient inks.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a faded ebon leather vestment beaded in pale bone || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afadedebonleathervestmentbeadedinpalebone&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afadedebonleathervestmentbeadedinpalebone&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this vestment is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This vestment is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your vestment is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered shroud of well-brushed wolf pelts || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alayeredshroudofwell-brushedwolfpelts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alayeredshroudofwell-brushedwolfpelts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a dark leather duster branded in skeletal designs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-adarkleatherdusterbrandedinskeletaldesigns&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adarkleatherdusterbrandedinskeletaldesigns&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a heavy ashen suede robe hung in various bone fetishes || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavyashensuederobehunginvariousbonefetishes&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavyashensuederobehunginvariousbonefetishes&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a charcoal felted wool overcoat with long buckskin lapels || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acharcoalfeltedwoolovercoatwithlongbuckskinlapels&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acharcoalfeltedwoolovercoatwithlongbuckskinlapels&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a shaggy bear fur coat covered in a myriad of buckles || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ashaggybearfurcoatcoveredinamyriadofbuckles&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashaggybearfurcoatcoveredinamyriadofbuckles&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a leaf-branded pale leather cloak shaded in gradient inks || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aleaf-brandedpaleleathercloakshadedingradientinks&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aleaf-brandedpaleleathercloakshadedingradientinks&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,100&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the tall male mannequin you see:||contents= a muted sepia tweed overcoat with umber leather pockets, a blackened grey nubuck longcoat hooked down each sleeve, a sigil-stitched raw linen gaberdine trimmed in thick suede, a rough leather-scaled robe dyed a matte jet black, a fitted navy blue leather coat with an iron-braced sleeve, a buckskin greatcloak caught with a thin copper pauldron and a snowy white silk longcloak mantled in tonal furs.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a muted sepia tweed overcoat with umber leather pockets || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amutedsepiatweedovercoatwithumberleatherpockets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amutedsepiatweedovercoatwithumberleatherpockets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a blackened grey nubuck longcoat hooked down each sleeve || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablackenedgreynubucklongcoathookeddowneachsleeve&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablackenedgreynubucklongcoathookeddowneachsleeve&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sigil-stitched raw linen gaberdine trimmed in thick suede || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asigil-stitchedrawlinengaberdinetrimmedinthicksuede&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asigil-stitchedrawlinengaberdinetrimmedinthicksuede&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this gaberdine is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This gaberdine is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your gaberdine is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rough leather-scaled robe dyed a matte jet black || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aroughleather-scaledrobedyedamattejetblack&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aroughleather-scaledrobedyedamattejetblack&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fitted navy blue leather coat with an iron-braced sleeve || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afittednavyblueleathercoatwithaniron-bracedsleeve&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afittednavyblueleathercoatwithaniron-bracedsleeve&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a buckskin greatcloak caught with a thin copper pauldron || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abuckskingreatcloakcaughtwithathincopperpauldron&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abuckskingreatcloakcaughtwithathincopperpauldron&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this greatcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This greatcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your greatcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a snowy white silk longcloak mantled in tonal furs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asnowywhitesilklongcloakmantledintonalfurs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asnowywhitesilklongcloakmantledintonalfurs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=a narrow building at the end of the wall&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=Map Room 3, go doorway&lt;br /&gt;
|fest=dr|year=2021|letter=C}}&lt;br /&gt;
===The Cover Up, Women&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Women&#039;s Room] 23752 2021-02-13 09:56:12 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Women&#039;s Room - 23752&lt;br /&gt;
|desc=The back of the shop has been decorated marginally more than the front room but still lacks flashy or ornate enhancements.  Delicate, candle-filled sconces provide the majority of lighting, while a recessed, double-paned window allows the sunlight to bathe the mannequins in warm, natural glow.  A doorway leads back into the men&#039;s section of the shop.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the tall female mannequin you see:||contents= a caramel mink cloak lined in flora-embroidered velvet, a silk-backed tatted ecru lace overcoat, a nacre-beaded dark sapphire suede longcoat, a lace-cut obsidian velvet duster lined in tonal leather, a flora-sewn iridescent lilac satin robe, a split-back greyish taupe tweed longcoat and an oiled ivory leather robe spilling layers of pale lace.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a caramel mink cloak lined in flora-embroidered velvet || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acaramelminkcloaklinedinflora-embroideredvelvet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acaramelminkcloaklinedinflora-embroideredvelvet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a silk-backed tatted ecru lace overcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asilk-backedtattedecrulaceovercoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilk-backedtattedecrulaceovercoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a nacre-beaded dark sapphire suede longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anacre-beadeddarksapphiresuedelongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anacre-beadeddarksapphiresuedelongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lace-cut obsidian velvet duster lined in tonal leather || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alace-cutobsidianvelvetdusterlinedintonalleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alace-cutobsidianvelvetdusterlinedintonalleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flora-sewn iridescent lilac satin robe || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aflora-sewniridescentlilacsatinrobe&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflora-sewniridescentlilacsatinrobe&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-back greyish taupe tweed longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asplit-backgreyishtaupetweedlongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asplit-backgreyishtaupetweedlongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| an oiled ivory leather robe spilling layers of pale lace || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anoiledivoryleatherrobespillinglayersofpalelace&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anoiledivoryleatherrobespillinglayersofpalelace&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the petite female mannequin you see:||contents= a chain-draped gilded wine lace shroud, a sage-colored wild silk robe banded in linden rings, a brushed amethyst wool longcoat with a high ivory tulle collar, a cognac nubuck leather coat blackened down the shoulders, a thorn-branded garnet leather duster, a rose gold raw silk cloak draped with soft furs and a fur-collared copper and turquoise tartan longcoat.}}&lt;br /&gt;
{| class=&amp;quot;wikitable col-5-right&amp;quot; {{prettytable}}&lt;br /&gt;
| a chain-draped gilded wine lace shroud || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-achain-drapedgildedwinelaceshroud&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-achain-drapedgildedwinelaceshroud&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sage-colored wild silk robe banded in linden rings || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asage-coloredwildsilkrobebandedinlindenrings&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asage-coloredwildsilkrobebandedinlindenrings&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a brushed amethyst wool longcoat with a high ivory tulle collar || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abrushedamethystwoollongcoatwithahighivorytullecollar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abrushedamethystwoollongcoatwithahighivorytullecollar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cognac nubuck leather coat blackened down the shoulders || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acognacnubuckleathercoatblackeneddowntheshoulders&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acognacnubuckleathercoatblackeneddowntheshoulders&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a thorn-branded garnet leather duster || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athorn-brandedgarnetleatherduster&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze, examine&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athorn-brandedgarnetleatherduster&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Examine:&#039;&#039;&#039;&amp;lt;br&amp;gt;You notice a skeletal dark alabaster clasp secured at the top of the garnet leather duster.&amp;lt;br&amp;gt;&lt;br /&gt;
a thorn-branded garnet leather duster&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rose gold raw silk cloak draped with soft furs || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-arosegoldrawsilkcloakdrapedwithsoftfurs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-arosegoldrawsilkcloakdrapedwithsoftfurs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1,100&lt;br /&gt;
|-&lt;br /&gt;
| a fur-collared copper and turquoise tartan longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afur-collaredcopperandturquoisetartanlongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afur-collaredcopperandturquoisetartanlongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&amp;lt;!-- end wiki output --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2021Q1 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==2020Q3==&lt;br /&gt;
&amp;lt;section begin=2020Q3 /&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=a narrow building&lt;br /&gt;
|location=[Map Room #3], Lich #26857, go narrow building&lt;br /&gt;
|fest=dr|year=2020|letter=C}}&lt;br /&gt;
===The Cover Up, Men&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Men&#039;s Room] 23751 2020-08-15 17:48:40 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Men&#039;s Room - 23751&lt;br /&gt;
|desc=Dark and reflective, the surrounding walls are covered in smooth ebony planks that have been secured with silver-headed nails.  A marble-topped iron stand with a small crystal bowl flanks one side of the entrance, and a pair of well-dressed mannequins have been situated in front of a tri-mirrored wall, giving the illusion of a much larger collection of display models.  Sheer black lace hangs over a doorway leading to the back of the shop.&lt;br /&gt;
|exits= out}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container2||container=On the iron stand you see:||contents=&amp;lt;br&amp;gt;&amp;lt;b&amp;gt;Containers [1]:&amp;lt;/b&amp;gt; a crystal bowl}}&lt;br /&gt;
{{Container2||container=In the bowl you see:||contents= some star-shaped mint chocolate.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| mint chocolate || || ||  || free&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
{{Container2||container=On the tall male mannequin you see:||contents= a flat-collared charcoal tweed overcoat with suede pockets, a muted green nubuck longcoat patched in umber suede, a grey-beige woven linen gaberdine with brass riveting, a matte burgundy leather robe branded with thin veining, a long onyx leather coat mantled in thick raven feathers, a fringed tan buckskin greatcloak reinforced by iron rings and a stone-colored textured silk longcloak with thick cuffs.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a flat-collared charcoal tweed overcoat with suede pockets || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aflat-collaredcharcoaltweedovercoatwithsuedepockets&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflat-collaredcharcoaltweedovercoatwithsuedepockets&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a muted green nubuck longcoat patched in umber suede || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amutedgreennubucklongcoatpatchedinumbersuede&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amutedgreennubucklongcoatpatchedinumbersuede&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a grey-beige woven linen gaberdine with brass riveting || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agrey-beigewovenlinengaberdinewithbrassriveting&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agrey-beigewovenlinengaberdinewithbrassriveting&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this gaberdine is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This gaberdine is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your gaberdine is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a matte burgundy leather robe branded with thin veining || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-amatteburgundyleatherrobebrandedwiththinveining&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-amatteburgundyleatherrobebrandedwiththinveining&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a long onyx leather coat mantled in thick raven feathers || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alongonyxleathercoatmantledinthickravenfeathers&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alongonyxleathercoatmantledinthickravenfeathers&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fringed tan buckskin greatcloak reinforced by iron rings || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afringedtanbuckskingreatcloakreinforcedbyironrings&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afringedtanbuckskingreatcloakreinforcedbyironrings&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this greatcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This greatcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your greatcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a stone-colored textured silk longcloak with thick cuffs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-astone-coloredtexturedsilklongcloakwiththickcuffs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-astone-coloredtexturedsilklongcloakwiththickcuffs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the short male mannequin you see:||contents= a black satin vestment with gold-threaded symbol arabesques, an asymmetric dark fustian shroud caught by knotted leather, a thin-buckled ivory leather duster cross-strapped in suede, a velvet-trimmed emerald suede robe with a heavy mesh hood, a flare-hemmed auburn suede overcoat with satin embroidery, a buttoned navy twill coat with a flared leather collar and a brushed grey wolf fur cloak layered with dark bear pelts.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a black satin vestment with gold-threaded symbol arabesques || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ablacksatinvestmentwithgold-threadedsymbolarabesques&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ablacksatinvestmentwithgold-threadedsymbolarabesques&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this vestment is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This vestment is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your vestment is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| an asymmetric dark fustian shroud caught by knotted leather || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anasymmetricdarkfustianshroudcaughtbyknottedleather&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anasymmetricdarkfustianshroudcaughtbyknottedleather&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a thin-buckled ivory leather duster cross-strapped in suede || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-athin-buckledivoryleatherdustercross-strappedinsuede&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-athin-buckledivoryleatherdustercross-strappedinsuede&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a velvet-trimmed emerald suede robe with a heavy mesh hood || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-avelvet-trimmedemeraldsuederobewithaheavymeshhood&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-avelvet-trimmedemeraldsuederobewithaheavymeshhood&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flare-hemmed auburn suede overcoat with satin embroidery || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aflare-hemmedauburnsuedeovercoatwithsatinembroidery&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflare-hemmedauburnsuedeovercoatwithsatinembroidery&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a buttoned navy twill coat with a flared leather collar || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abuttonednavytwillcoatwithaflaredleathercollar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abuttonednavytwillcoatwithaflaredleathercollar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a brushed grey wolf fur cloak layered with dark bear pelts || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-abrushedgreywolffurcloaklayeredwithdarkbearpelts&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abrushedgreywolffurcloaklayeredwithdarkbearpelts&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1100&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up&lt;br /&gt;
|look=&amp;lt;!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--&amp;gt;&lt;br /&gt;
|location=[Map Room #], Lich# 23751, go doorway&lt;br /&gt;
|fest=dr|year=2020|letter=C}}&lt;br /&gt;
===The Cover Up, Women&#039;s Room===&amp;lt;!--==={{{ [The Cover Up, Women&#039;s Room] 23752 2020-08-15 17:49:33 -0500}}}===--&amp;gt;&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Women&#039;s Room - 23752&lt;br /&gt;
|desc=The back of the shop has been decorated marginally more than the front room but still lacks any flashy or ornate enhancements.  Delicate, candle-filled sconces provide the majority of lighting, while a recessed, double-paned window allows the moonlight to bathe the mannequins in warm, natural glow.  A doorway leads back into the men&#039;s section of the shop.&lt;br /&gt;
|exits= none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
{{Container2||container=On the tall female mannequin you see:||contents= a chain-draped red jacquard cloak beaded in onyx teardrops, a leather-skirted iridescent silk overcoat, a smoky emerald suede longcoat with onyx lace cuffs, a plum velvet duster with rings pierced down each sleeve, a layered robe of overlapping autumnal-dyed satin leaves, a cobalt velvet longcoat with crescent-strung chains and a grey-dipped ecru lace robe caught with black silk ribbons.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a chain-draped red jacquard cloak beaded in onyx teardrops || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-achain-drapedredjacquardcloakbeadedinonyxteardrops&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-achain-drapedredjacquardcloakbeadedinonyxteardrops&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a leather-skirted iridescent silk overcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aleather-skirtediridescentsilkovercoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aleather-skirtediridescentsilkovercoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a smoky emerald suede longcoat with onyx lace cuffs || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-asmokyemeraldsuedelongcoatwithonyxlacecuffs&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asmokyemeraldsuedelongcoatwithonyxlacecuffs&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a plum velvet duster with rings pierced down each sleeve || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-aplumvelvetdusterwithringspierceddowneachsleeve&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aplumvelvetdusterwithringspierceddowneachsleeve&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered robe of overlapping autumnal-dyed satin leaves || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alayeredrobeofoverlappingautumnal-dyedsatinleaves&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alayeredrobeofoverlappingautumnal-dyedsatinleaves&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cobalt velvet longcoat with crescent-strung chains || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-acobaltvelvetlongcoatwithcrescent-strungchains&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acobaltvelvetlongcoatwithcrescent-strungchains&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a grey-dipped ecru lace robe caught with black silk ribbons || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-agrey-dippedecrulacerobecaughtwithblacksilkribbons&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agrey-dippedecrulacerobecaughtwithblacksilkribbons&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container2||container=On the petite female mannequin you see:||contents= a nacreous black lace shroud lined in burnt burgundy velvet, a lattice-woven pale chainsil robe, a tall-collared ink blue brocade longcoat, a fitted saffron suede coat with a jet-beaded velvet collar, a well-oiled black leather duster slit high down each side, a long raw silk cloak dyed in a gradient of jewel tones and a metallic emerald and gold plumille longcoat.}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a nacreous black lace shroud lined in burnt burgundy velvet || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-anacreousblacklaceshroudlinedinburntburgundyvelvet&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anacreousblacklaceshroudlinedinburntburgundyvelvet&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lattice-woven pale chainsil robe || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alattice-wovenpalechainsilrobe&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alattice-wovenpalechainsilrobe&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a tall-collared ink blue brocade longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-atall-collaredinkbluebrocadelongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-atall-collaredinkbluebrocadelongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fitted saffron suede coat with a jet-beaded velvet collar || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-afittedsaffronsuedecoatwithajet-beadedvelvetcollar&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-afittedsaffronsuedecoatwithajet-beadedvelvetcollar&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a well-oiled black leather duster slit high down each side || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-awell-oiledblackleatherdusterslithighdowneachside&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awell-oiledblackleatherdusterslithighdowneachside&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
| a long raw silk cloak dyed in a gradient of jewel tones || Weight: 6 pounds &amp;lt;br&amp;gt;Pocketed: huge (140-159)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-alongrawsilkcloakdyedinagradientofjeweltones&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alongrawsilkcloakdyedinagradientofjeweltones&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a metallic emerald and gold plumille longcoat || Weight: 9 pounds &amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;|| cloak-worn&amp;lt;br&amp;gt;functional&lt;br /&gt;
| &amp;lt;div class=&amp;quot;mw-customtoggle-ametallicemeraldandgoldplumillelongcoat&amp;quot; role=&amp;quot;link&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;analyze&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ametallicemeraldandgoldplumillelongcoat&amp;quot;&amp;gt;&#039;&#039;&#039;Analyze:&#039;&#039;&#039;&amp;lt;br&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;br&amp;gt;&amp;lt;/div&amp;gt;&lt;br /&gt;
| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;!-- Other Rooms Here  --&amp;gt;&lt;br /&gt;
&amp;lt;section end=2020Q3 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Previous Inventory==&lt;br /&gt;
&amp;lt;section begin=current /&amp;gt;&amp;lt;includeonly&amp;gt;&lt;br /&gt;
==The Cover Up== &amp;lt;/includeonly&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;Opened&#039;&#039;&#039;: Unknown; &#039;&#039;&#039;Inventory Updates&#039;&#039;&#039;: August 2019; &#039;&#039;&#039;Verified:&#039;&#039;&#039; 08/14/2019, 2/13/2020&lt;br /&gt;
&lt;br /&gt;
{{Festshop&lt;br /&gt;
|shopname=The Cover Up, Men&#039;s Room&lt;br /&gt;
|look=a narrow building&lt;br /&gt;
|location=[Map Room #3], Lich #26857, go building}}&lt;br /&gt;
===Men&#039;s Room===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Men&#039;s Room&lt;br /&gt;
|desc=Dark and reflective, the surrounding walls are covered in smooth ebony planks that have been secured with silver-headed nails.  A marble-topped iron stand with a small crystal bowl flanks one side of the entrance, and a pair of well-dressed mannequins have been situated in front of a tri-mirrored wall, giving the illusion of a much larger collection of display models.  Sheer black lace hangs over a doorway leading to the back of the shop.  You also see a tall male mannequin with some stuff on it and a short male mannequin with some stuff on it.&lt;br /&gt;
|exits = out}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the crystal bowl you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
|some star-shaped mint chocolate&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a long onyx fur cloak draped with narrow chains on the shoulders || Weight: 6 pounds&amp;lt;br&amp;gt;Pocketed: &amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-alongonyxfurcloakdrapedwithnarrowchainsontheshoulders&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alongonyxfurcloakdrapedwithnarrowchainsontheshoulders&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;You can tell that the cloak is as light as it can get and that its pockets could not possibly get any deeper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a wide-lapeled plum leather longcoat with grey silk lining || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-awide-lapeledplumleatherlongcoatwithgreysilklining&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-awide-lapeledplumleatherlongcoatwithgreysilklining&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flare-hemmed auburn suede overcoat with russet satin embroidery || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aflare-hemmedauburnsuedeovercoatwithrussetsatinembroidery&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflare-hemmedauburnsuedeovercoatwithrussetsatinembroidery&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered malachite-hued robe with copper detailing || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-alayeredmalachite-huedrobewithcopperdetailing&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alayeredmalachite-huedrobewithcopperdetailing&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rustic bazan duster with a tall oak-beaded collar || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-arusticbazandusterwithatalloak-beadedcollar&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-arusticbazandusterwithatalloak-beadedcollar&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an ebon-sheened indigo fustian shroud with pewter threading || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-anebon-sheenedindigofustianshroudwithpewterthreading&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anebon-sheenedindigofustianshroudwithpewterthreading&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a heavily embroidered gold satin vestment edged in emerald || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aheavilyembroideredgoldsatinvestmentedgedinemerald&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aheavilyembroideredgoldsatinvestmentedgedinemerald&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this vestment is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This vestment is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your vestment is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a flannel-lined sisken overcoat with bronze whipstitching || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aflannel-linedsiskenovercoatwithbronzewhipstitching&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aflannel-linedsiskenovercoatwithbronzewhipstitching&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jet black kidskin longcoat with braid-detailed lapels || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ajetblackkidskinlongcoatwithbraid-detailedlapels&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ajetblackkidskinlongcoatwithbraid-detailedlapels&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a charcoal leather gaberdine edged with metallic silver webbing || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-acharcoalleathergaberdineedgedwithmetallicsilverwebbing&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-acharcoalleathergaberdineedgedwithmetallicsilverwebbing&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this gaberdine is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This gaberdine is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your gaberdine is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a slashed wine-hued suede robe with obsidian marbrinus underlay || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aslashedwine-huedsuederobewithobsidianmarbrinusunderlay&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aslashedwine-huedsuederobewithobsidianmarbrinusunderlay&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a glaes-studded raven leather coat with flared sleeve cuffs || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aglaes-studdedravenleathercoatwithflaredsleevecuffs&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aglaes-studdedravenleathercoatwithflaredsleevecuffs&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-hemmed buckskin greatcloak with a puma fur mantle || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-asplit-hemmedbuckskingreatcloakwithapumafurmantle&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asplit-hemmedbuckskingreatcloakwithapumafurmantle&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this greatcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This greatcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your greatcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a scarlet lyraigne longcloak with a deep flame-cut hemline || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ascarletlyraignelongcloakwithadeepflame-cuthemline&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ascarletlyraignelongcloakwithadeepflame-cuthemline&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Women&#039;s Room===&lt;br /&gt;
{{RoomDescription|&lt;br /&gt;
|roomname=The Cover Up, Women&#039;s Room&lt;br /&gt;
|desc=The back of the shop has been decorated marginally more than the front room but still lacks any flashy or ornate enhancements.  Delicate, candle-filled sconces provide the majority of lighting, while a recessed, double-paned window allows the moonlight to bathe the mannequins in warm, natural glow.  A doorway leads back into the men&#039;s section of the shop.  You also see a petite female mannequin with some stuff on it and a tall female mannequin with some stuff on it.&lt;br /&gt;
|exits = none}}&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
&#039;&#039;&#039;&amp;lt;big&amp;gt;[[Whisper cloak]]&amp;lt;/big&amp;gt;&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a bone white sindon shroud shot through with pewter threading || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-abonewhitesindonshroudshotthroughwithpewterthreading&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abonewhitesindonshroudshotthroughwithpewterthreading&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this shroud is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This shroud is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your shroud is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a bell-sleeved ashen byssine robe with subtle fretwork details || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-abell-sleevedashenbyssinerobewithsubtlefretworkdetails&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-abell-sleevedashenbyssinerobewithsubtlefretworkdetails&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jet-on-silver brocade longcoat with a wedge back vent || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ajet-on-silverbrocadelongcoatwithawedgebackvent&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ajet-on-silverbrocadelongcoatwithawedgebackvent&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a burgundy suede coat with feathery bronze embroidery || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aburgundysuedecoatwithfeatherybronzeembroidery&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aburgundysuedecoatwithfeatherybronzeembroidery&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this coat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This coat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your coat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a satin-lined cobalt sarcenet duster with darts at the waist || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-asatin-linedcobaltsarcenetdusterwithdartsatthewaist&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asatin-linedcobaltsarcenetdusterwithdartsatthewaist&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a dusty amethyst ridgeweaver silk cloak with indigo pearl beading || Weight: 6 pounds&amp;lt;br&amp;gt;Pocketed: &amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-adustyamethystridgeweaversilkcloakwithindigopearlbeading&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-adustyamethystridgeweaversilkcloakwithindigopearlbeading&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 2/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your cloak is fully unlocked.  Available verbs: clean, flip, fold, pull, ponder, raise, remove, rub, snap, tickle, touch, turn, wear, whisper.&amp;lt;br&amp;gt;You can tell that the cloak is as light as it can get and that its pockets could not possibly get any deeper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a silver-chased violet plumille longcoat with satin lapels || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-asilver-chasedvioletplumillelongcoatwithsatinlapels&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-asilver-chasedvioletplumillelongcoatwithsatinlapels&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a shoulder-slung cerulean damask cloak with argent satin lining || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ashoulder-slungceruleandamaskcloakwithargentsatinlining&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ashoulder-slungceruleandamaskcloakwithargentsatinlining&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this cloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This cloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your cloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a goldenrod charmeuse overcoat with abstract garnet embroidery || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-agoldenrodcharmeuseovercoatwithabstractgarnetembroidery&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-agoldenrodcharmeuseovercoatwithabstractgarnetembroidery&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this overcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This overcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your overcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an austere onyx suede longcoat fettered with leather straps || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-anaustereonyxsuedelongcoatfetteredwithleatherstraps&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-anaustereonyxsuedelongcoatfetteredwithleatherstraps&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcoat is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcoat is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcoat is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jewel-toned bourde duster with gold zig-zag stitching || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-ajewel-tonedbourdedusterwithgoldzig-zagstitching&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-ajewel-tonedbourdedusterwithgoldzig-zagstitching&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this duster is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This duster is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your duster is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lengthy aquamarine marbrinus robe with a sharkbite hem || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-alengthyaquamarinemarbrinusrobewithasharkbitehem&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-alengthyaquamarinemarbrinusrobewithasharkbitehem&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cerulean velvet longcloak embossed with stars || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-aceruleanvelvetlongcloakembossedwithstars&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-aceruleanvelvetlongcloakembossedwithstars&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this longcloak is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This longcloak is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your longcloak is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an alabaster tatted lace robe with a roseate silk underlay || Weight: 9 pounds&amp;lt;br&amp;gt;Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items|| functional|| &amp;lt;div class=&amp;quot;mw-customtoggle-analabastertattedlacerobewitharoseatesilkunderlay&amp;quot; style=&amp;quot;text-decoration: underline&amp;quot;&amp;gt;&lt;br /&gt;
analyze&lt;br /&gt;
&amp;lt;/div&amp;gt;&lt;br /&gt;
&amp;lt;div class=&amp;quot;mw-collapsible mw-collapsed&amp;quot; id=&amp;quot;mw-customcollapsible-analabastertattedlacerobewitharoseatesilkunderlay&amp;quot;&amp;gt;This item can be altered, but it needs to remain a worn, LONG, container with some kind of a clasp, which should remain a singular item, and should be able to be flipped (ie: no frog closures).  In addition, the clasp portion of this robe is fully alterable.  This clasp does NOT need to be included in the base/long of the item.  This robe is Tier 0/2.  Original merchant: Xanai, Duskruin.&amp;lt;br&amp;gt;There is an auto-close feature when the item is worn.  You can toggle this with PROD.&amp;lt;br&amp;gt;Your robe is not yet unlocked.  Some merchants may be willing to unlock this to the next tier.  Available verbs: fold, prod, remove, tickle, touch, wear, whisper.&amp;lt;/div&amp;gt;&lt;br /&gt;
|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&amp;lt;section end=current /&amp;gt;&lt;br /&gt;
==Archived Inventory==&lt;br /&gt;
&amp;lt;section begin=archive /&amp;gt;&amp;lt;includeonly&amp;gt;&lt;br /&gt;
==The Cover Up==&amp;lt;/includeonly&amp;gt;&lt;br /&gt;
===Retired August 2019===&lt;br /&gt;
====Men&#039;s Room====&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=In the crystal bowl you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
|some star-shaped mint chocolate&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a suede-harnessed black wool robe|| Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=7 | T0 [[Whisper cloak | Whisper Cloaks]]|| 75&lt;br /&gt;
|-&lt;br /&gt;
| some bronze-sheened green viper skin robes|| Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a shoulder-strapped obsidian leather coat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a gilt-traced crimson leather longcloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cobalt suede cassock stitched with silvered thread || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a weathered cordovan leather longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a heavy whiskey brown twill overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a high-collared ashen wool cloak edged with kelyn rivets || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional || T2 [[Whisper cloak | Whisper Cloak]] || 1100&lt;br /&gt;
|-&lt;br /&gt;
| a navy leather overcoat mantled in dark oilskin || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=6 | T0 [[Whisper cloak | Whisper Cloaks]] || 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-tailed olive suede coat cuffed in tonal leather || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sanguine-dyed wool robe with long blackened sleeves || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a bark-colored kidskin cloak caught in graduated layers || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a pristine white silk cassock with a stiff leather collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flare-collared smoky charcoal tweed longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a pale cream-colored flyrsilk cloak with pendant sleeves || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| T2 [[Whisper cloak]]|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a garnet-dyed velvet coat with a scalloped lacework collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=6 | T0 [[Whisper cloak | Whisper Cloaks]] || 75&lt;br /&gt;
|-&lt;br /&gt;
| an oiled onyx snakeskin robe with a faint green sheen || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a silk-lined cloak of long ivory swan feathers || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a short-collared dark lavender brocade pelisse || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| some green-black velvet robes with textured leather sleeves || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a layered heather grey wool longcloak embroidered in ivory || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a pale vanilla rose-cut lace coat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=7 | T0 [[Whisper cloak | Whisper Cloaks]]|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a leaf-patterned emerald flyrsilk longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an asymmetrically draped smoke grey suede cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a pastel aquamarine paisley silk pelisse || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a jade-on-onyx brocade coat trimmed in dark mink || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an ermine-edged niveous nubuck leather overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a chele-trimmed muted citrine silk longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
===February 2018 Items===&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
====Men’s Room====&lt;br /&gt;
&#039;&#039;&#039;Opened&#039;&#039;&#039;: Unknown; &#039;&#039;&#039;Inventory Updates&#039;&#039;&#039;: February 2018; &#039;&#039;&#039;Verified:&#039;&#039;&#039; 2/24/18, 6/16/18&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a distressed grey burlap cassock || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional||rowspan=7 | [[Whisper cloak | Whisper Cloaks]] || 75&lt;br /&gt;
|-&lt;br /&gt;
| a stained ink black leather cassock || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a formal ebony longcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a velvet-lined russet robe || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a voluminous ebon silk longcloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| an elaborate obsidian cape with detailed viridian stitching || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a thick midnight blue fur cloak || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| an elegant grey cloak with delicate lacework along the hems || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a stately black cape with a stiff collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a multi-pocketed dark kidskin overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rune-covered blood red wool cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a split-tailed longcoat adorned with crow feathers || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a deeply cowled black linen greatcloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a caramel-hued longcoat with understated auburn accents || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&amp;lt;blockquote&amp;gt;&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{{big|&#039;&#039;&#039;[[Whisper cloak]]s}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a deeply cowled obsidian cloak lined with umber silk || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a flowing sealskin coat adorned with glossy black beads || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| some embroidered flyrsilk robes || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a formal grey floor-length flyrsilk cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a delicate emerald silk longcloak embroidered with crimson sigils || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a deep grey and green silk cloak || Pocketed: Huge (140-159)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a two-toned emerald and ebony velvet cape lined with ruby silk || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a regal pitch black cloak interwoven with teardrop sapphires || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a lavish black puma fur overcoat || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a sleek black leather longcoat with a stiff high collar || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a blood red robe with midnight black trim || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a dark-toned sapphire flyrsilk cloak || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a frilly grey overcoat with lacy emerald trim || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
| a rich ebony velvet cape with bright white embroidered trim || Pocketed: Significant (100-119)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 75&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&amp;lt;/blockquote&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===2015 Items===&lt;br /&gt;
&#039;&#039;Room 3: a narrow building&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;&#039;[[Whisper cloak]]s&lt;br /&gt;
====Men&#039;s Room====&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the short male mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|some flowing grey and silver marbrinus robes&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a double-breasted dark leather longcoat&lt;br /&gt;
|750&lt;br /&gt;
|unlocked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a hooded ebon-hued velvet robe&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a tailored longcoat lined with dark silk&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a dual-toned grey bourde cassock edged with silver piping&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the tall male mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|a long midnight blue greatcloak&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a tenebrous black cloak lined with smooth satin&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a black linen overcoat with wide-cuffed sleeves&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the petite female mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|a billowing sanguine cape adorned with fiery jacinth beading&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a flowing black silk cloak dappled with red dreamstones&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a black velvet cape lined with rich burgundy silk&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a sable lambswool cloak trimmed with ebon-tipped fox tails&lt;br /&gt;
|750&lt;br /&gt;
|unlocked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|an ankle-length deep russet coat with a fitted waist.&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
&#039;&#039;On the tall female mannequin:&#039;&#039;&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
!bgcolor=#DDDDDD|Item&lt;br /&gt;
!bgcolor=#DDDDDD|Bloodscrip&lt;br /&gt;
!bgcolor=#DDDDDD|Info&lt;br /&gt;
|-&lt;br /&gt;
|some elegant grey-on-black chainsil robes&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a dark silk mantle with a wool capelet&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a cowled midnight-hued cloak with a subtle blued sheen&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|a coal black velvet pelisse&lt;br /&gt;
|75&lt;br /&gt;
|locked whisper cloak&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
===2/24/18 Update===&lt;br /&gt;
&lt;br /&gt;
====Men&#039;s Room====&lt;br /&gt;
&#039;&#039;&#039;[[Whisper cloak]]s&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the short male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a satin-lined smoke grey paeline cloak || Pocketed:Huge (150 lbs)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a high-collared black wool cape ||rowspan=&amp;quot;6&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;6&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;6&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a deep mocha wool longcoat&lt;br /&gt;
|-&lt;br /&gt;
| some thick black velvet robes &lt;br /&gt;
|-&lt;br /&gt;
| a split-tailed obsidian longcoat &lt;br /&gt;
|-&lt;br /&gt;
| a hooded dark silk robe&lt;br /&gt;
|-&lt;br /&gt;
| a black-on-grey bourde cassock with thick silver piping&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall male mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a thick panther fur greatcloak ||rowspan=&amp;quot;6&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;6&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;6&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a fur-lined dark chestnut cloak&lt;br /&gt;
|-&lt;br /&gt;
| an iron grey silk cloak &lt;br /&gt;
|-&lt;br /&gt;
| a charcoal-hued overcoat adorned with silver-threaded knotwork&lt;br /&gt;
|-&lt;br /&gt;
| a sigil-covered crimson silk cape &lt;br /&gt;
|-&lt;br /&gt;
| a dark satin overcoat with ebon leather edging&lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
====Women&#039;s Room====&lt;br /&gt;
&#039;&#039;&#039;[[Whisper cloak]]s&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the petite female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
|-&lt;br /&gt;
| a crimson silk longcloak with gold-on-red jacquard edging || Pocketed:Huge (150 lbs)&amp;lt;br&amp;gt;any number of items||cloak-worn&amp;lt;br&amp;gt;functional|| 1100&lt;br /&gt;
|-&lt;br /&gt;
| a black velvet cape lined with deep plum silk ||rowspan=&amp;quot;6&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;6&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;6&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a full black silk cloak with gem-studded serpentine designs &lt;br /&gt;
|-&lt;br /&gt;
| a deep russet coat with a ribbon-cinched waist&lt;br /&gt;
|-&lt;br /&gt;
| a rich burgundy chainsil cloak laced with dark velvet ribbon &lt;br /&gt;
|-&lt;br /&gt;
| a billowy sanguine cape adorned with star sapphire beading &lt;br /&gt;
|-&lt;br /&gt;
| a shadowy obsidian silk cloak trimmed with cormorant feathers &lt;br /&gt;
|-&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
{{Container|&lt;br /&gt;
|container=On the tall female mannequin you see:}}&lt;br /&gt;
{| {{prettytable}}&lt;br /&gt;
| a high-collared dark crimson brocade cape ||rowspan=&amp;quot;7&amp;quot;| Pocketed:Signif (100-119)&amp;lt;br&amp;gt;any number of items||rowspan=&amp;quot;7&amp;quot;|cloak-worn&amp;lt;br&amp;gt;functional||rowspan=&amp;quot;7&amp;quot;| 75&lt;br /&gt;
|-&lt;br /&gt;
| a cowled obsidian cloak with a black lace hem &lt;br /&gt;
|-&lt;br /&gt;
| a dark-toned sapphire flyrsilk cloak &lt;br /&gt;
|-&lt;br /&gt;
| some full umber and gold brocade robes &lt;br /&gt;
|-&lt;br /&gt;
| a velvet-lined deep emerald silk cloak &lt;br /&gt;
|-&lt;br /&gt;
| a pewter-threaded dark velvet pelisse&lt;br /&gt;
|-&lt;br /&gt;
| a sleek charcoal velvet cloak with ornamental silver trim &lt;br /&gt;
|-&lt;br /&gt;
|}&amp;lt;section end=archive /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
[[Category: Bloodriven Village Shops|T]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Divine_Incarnation_(1650)&amp;diff=130233</id>
		<title>Divine Incarnation (1650)</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Divine_Incarnation_(1650)&amp;diff=130233"/>
		<updated>2020-03-25T15:01:01Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: /* Messaging */ Changed from Charl to Huntress&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;{{Spell&lt;br /&gt;
 | mnemonic = DINCA&lt;br /&gt;
 | duration = 5 minutes or divine energy is expired&lt;br /&gt;
 | cooldown = 10 minutes&lt;br /&gt;
 | span = [[Single Cast]]&lt;br /&gt;
 | type = Utility&lt;br /&gt;
 | subtype = Offensive, Defensive&lt;br /&gt;
 | skill = None&lt;br /&gt;
 | components = None&lt;br /&gt;
 | availability = Self-cast&lt;br /&gt;
 | navigation = {{Paladin base navigation}}&lt;br /&gt;
}}&lt;br /&gt;
__TOC__&lt;br /&gt;
The paladin becomes the divine incarnation of their deity.  While incarnated the paladin is granted 30 &#039;&#039;&#039;Divine Energy&#039;&#039;&#039; that may be used to call upon the powers of their deity using the{{boldmono| INCARNATE }}verb. &#039;&#039;&#039;Divine Incarnation&#039;&#039;&#039; has a 10 minute cooldown that begins when the spell is cast.  Divine Incarnation has been updated to provide a cooldown reduction based upon the amount of unused Divine Energy.  The rate of the cooldown reduction will be 10 seconds for each unused Divine Energy point remaining from the base 30 pool.  Additional Divine Energy earned through training in [[Spiritual Mana Control]] is NOT counted for cooldown reduction.&lt;br /&gt;
&lt;br /&gt;
The{{mono| INCARNATE }}verb gives the paladin access to four unique abilities that drain Divine Energy from their available pool.  Those abilities are &#039;&#039;&#039;ZEAL&#039;&#039;&#039;, &#039;&#039;&#039;ARMOR&#039;&#039;&#039;, &#039;&#039;&#039;SMITE&#039;&#039;&#039; and &#039;&#039;&#039;ONSLAUGHT&#039;&#039;&#039;. Each offensive &#039;&#039;&#039;INCARNATE&#039;&#039;&#039; ability incurs 3 seconds of hard [[roundtime]] and each buff ability incurs 3 seconds of cast roundtime.  While under the effects of Divine Incarnation, the paladin may also use{{boldmono| INCARNATE ENERGY }}to check their &#039;&#039;&#039;Divine Energy Pool&#039;&#039;&#039;.&lt;br /&gt;
&lt;br /&gt;
== Usage ==&lt;br /&gt;
*{{boldmono|INCARNATE [option] {target} }}&lt;br /&gt;
*{{boldmono|INCARNATE ENERGY }}to check the Divine Energy Pool&lt;br /&gt;
&lt;br /&gt;
==Mana Control Benefit==&lt;br /&gt;
Training in [[Spiritual Mana Control]] increases the total amount of the Divine Energy Pool by one divine energy per 5 ranks.&lt;br /&gt;
{|&lt;br /&gt;
|&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;width:100%; text-align:center;&amp;quot;&lt;br /&gt;
!style=&amp;quot;text-align:right&amp;quot;|Spiritual Mana Control ranks||0||5||10||15||20||25||30||35||40||45||50&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total Divine Energy Pool||30||31||32||33||34||35||36||37||38||39||40&lt;br /&gt;
|}&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;width:100%; text-align:center;&amp;quot;&lt;br /&gt;
!style=&amp;quot;text-align:right&amp;quot;|Spiritual Mana Control ranks||60||70||80||90||100||110||120||130||140||150&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total Divine Energy Pool||42||44||46||48||50||52||54||56||58||60&lt;br /&gt;
|-&lt;br /&gt;
|colspan=11|&amp;lt;small&amp;gt;&#039;&#039;Not all thresholds shown&amp;lt;/small&amp;gt;&lt;br /&gt;
|}&lt;br /&gt;
|}&lt;br /&gt;
{{top}}&lt;br /&gt;
== Abilities and Lore Benefits ==&lt;br /&gt;
===Zeal=== &lt;br /&gt;
*Cost: 5 divine energy for base 5 flares, +1 divine energy per additional flare&lt;br /&gt;
&lt;br /&gt;
Zeal will cause a divine aura to surround the paladin and trigger deity specific flares upon the next 5 successful attacks made during the next 30 seconds.  If time allows, additional flares may be triggered at a cost of 1 divine energy each.  Training in [[Spiritual Lore, Summoning]] increases the duration of Zeal by 2 seconds per a seed 10 [[summation]] of ranks.&lt;br /&gt;
&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;text-align:center;&amp;quot;&lt;br /&gt;
!style:&amp;quot;text-align:right&amp;quot;|Spiritual Lore, Summoning ranks||0||10||21||33||46||60||75||91||108||126||145||165||186||208||231&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total duration (seconds)||30||31||32||33||34||35||36||37||38||39||40||41||42||43||44&lt;br /&gt;
|}&lt;br /&gt;
===Armor===&lt;br /&gt;
*Cost: 15 divine energy, 20 divine energy if used during an &amp;quot;emergency&amp;quot;&lt;br /&gt;
&lt;br /&gt;
Armor causes a holy armor to surround the paladin.  This grants a 50% [[resistance]] to all forms of attack for 30 seconds.  This spell can be invoked in an &amp;quot;emergency&amp;quot; situation once a day, which is defined as using the ability during a time other actions could not be performed (i.e., in roundtime, [[stunned]], [[:Category:Status Conditions|etc.]]). Divine Incarnation must be active in order to invoke an &amp;quot;emergency&amp;quot; usage of Armor.  This ability can only be invoked twice per cast of the spell.  Training in [[Spiritual Lore, Blessings]] increases the resistance effect of Armor by 2% per seed 5 summation of ranks, and the number of emergency uses of it per day by one at 50 and 125 ranks.&lt;br /&gt;
{|&lt;br /&gt;
|&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;width:100%; text-align:center;&amp;quot;&lt;br /&gt;
|+ &#039;&#039;&#039;Resistance Effect&#039;&#039;&#039;&lt;br /&gt;
|-&lt;br /&gt;
!style:&amp;quot;text-align:right;&amp;quot;|Spiritual Lore, Blessings ranks||0||5||11||18||26||35||45||56||68||81&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total resistance effect||50%||52%||54%||56%||58%||60%||62%||64%||66%||68%&lt;br /&gt;
|}&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;width:100%; text-align:center;&amp;quot;&lt;br /&gt;
!style:&amp;quot;text-align:right;&amp;quot;|Spiritual Lore, Blessings ranks||95||110||126||143||161||180||200||221||243&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total resistance effect||70%||72%||74%||76%||78%||80%||82%||84%||86%&lt;br /&gt;
|}&lt;br /&gt;
|}&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;text-align:center;&amp;quot;&lt;br /&gt;
|+ &#039;&#039;&#039;Emergency Uses Per Day&lt;br /&gt;
|-&lt;br /&gt;
!style:&amp;quot;text-align:right;&amp;quot;|Spiritual Lore, Blessings ranks||0||50||125&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total uses per day||1||2||3&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
===Smite===&lt;br /&gt;
*Cost: 5 divine energy drained on a successful hit only&lt;br /&gt;
&lt;br /&gt;
Smite causes a bolt of divine energy to leap from the paladin&#039;s weapon and attempt to strike the target.  This is an [[SMRv2]] based attack for which the strength can be increased by training in [[Paladin Base]] spell ranks.  Training in [[Spiritual Lore, Religion]] provides a Spiritual Lore Religion Ranks / 1.5 = Chance for a second Smite strike at no divine energy cost.&lt;br /&gt;
{|&lt;br /&gt;
|&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;text-align:center;&amp;quot;&lt;br /&gt;
|-&lt;br /&gt;
!style:&amp;quot;text-align:right;&amp;quot;|Spiritual Lore, Religion ranks||15||30||45||60||75||90||105||120||135||150&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Chance for a second Smite strike||10%||20%||30%||40%||50%||60%||70%||80%||90%||100%&lt;br /&gt;
|}&lt;br /&gt;
&lt;br /&gt;
===Onslaught===&lt;br /&gt;
*Cost: 15 divine energy&lt;br /&gt;
&lt;br /&gt;
Onslaught causes the paladin to become consumed with the energy of their deity and carry out a vicious onslaught.  The paladin will attempt to strike each target (similar to [[MSTRIKE]], but affects creatures and players) that is present in the room, ignoring 50% of its [[stance]].  Training in [[Spiritual Lore, Religion]] increases the percentage of the target&#039;s stance that is ignored by 1% per (seed 1 * 2) summation of ranks.&lt;br /&gt;
{|&lt;br /&gt;
|&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;width:100%; text-align:center;&amp;quot;&lt;br /&gt;
!style=&amp;quot;text-align:right&amp;quot;|Spiritual Lore, Religion ranks||0||2||6||12||20||30||42||56&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total stance ignored||50%||51%||52%||53%||54%||55%||56%||57%&lt;br /&gt;
|}&lt;br /&gt;
:{| class=&amp;quot;wikitable&amp;quot; style=&amp;quot;width:100%; text-align:center;&amp;quot;&lt;br /&gt;
!style=&amp;quot;text-align:right&amp;quot;|Spiritual Lore, Religion ranks||72||90||110||132||156||182||210||240&lt;br /&gt;
|-&lt;br /&gt;
|style=&amp;quot;text-align:right&amp;quot;|Total stance ignored||58%||59%||60%||61%||62%||63%||64%||65%&lt;br /&gt;
|}&lt;br /&gt;
|}&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
==Messaging==&lt;br /&gt;
{{deity messaging | link = Deity_messaging#Divine_Incarnation_.281650.29}}&lt;br /&gt;
&lt;br /&gt;
{{#section:Deity messaging|The Huntress 1650}} &amp;lt;!-- replace Charl with another if/when another has completed messaging --&amp;gt;&lt;br /&gt;
&lt;br /&gt;
==Resources==&lt;br /&gt;
*[[/saved posts|Saved posts]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
	<entry>
		<id>https://gswiki.play.net/index.php?title=Deity_messaging&amp;diff=130232</id>
		<title>Deity messaging</title>
		<link rel="alternate" type="text/html" href="https://gswiki.play.net/index.php?title=Deity_messaging&amp;diff=130232"/>
		<updated>2020-03-25T14:58:31Z</updated>

		<summary type="html">&lt;p&gt;SYNATHAESIA: /* Lesser Spirits */ Added the huntress messaging&lt;/p&gt;
&lt;hr /&gt;
&lt;div&gt;This page contains the unique messaging for spells and abilities that depend on a character&#039;s deity alignment (via [[CONVERT]]).  Information on this page will feed into each Arkati&#039;s/Spirit&#039;s individual article (i.e. to see all of the Ronan messaging collected, view the [[Ronan]] article).&lt;br /&gt;
&lt;br /&gt;
{{TOC limit|2}}&lt;br /&gt;
&lt;br /&gt;
== Chant ==&lt;br /&gt;
For clerics and paladins, {{boldmono|[[CHANT (verb)|CHANT]]}} results in a deity-specific prayer or orison.&lt;br /&gt;
===Pantheon of Liabo===&lt;br /&gt;
;Charl &amp;lt;section begin=Charl chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for the power of a squall to manifest in you by Charl&#039;s hand.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the power of a squall to manifest in him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Charl, causing sea blue and emerald light to momentarily coalesce in front of you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing sea blue and emerald light to momentarily coalesce in front of him.&amp;lt;section end=Charl chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Cholen for creativity and joy to inspire you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for creativity and joy to inspire him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Cholen, causing crimson and gold light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing crimson and gold light to momentarily coalesce in front of him.&amp;lt;section end=Cholen chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for the heat of Eonak&#039;s forge to empower you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the heat of the forge to empower her.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Eonak, causing pale golden and brown light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing pale golden and brown light to momentarily coalesce in front of her.&amp;lt;section end=Eonak chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Imaera for a bountiful harvest.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for a bountiful harvest.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Imaera, causing golden brown and green light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chant a short prayer, causing golden brown and green light to momentarily coalesce in front of him.&amp;lt;section end=Imaera chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Jastev to grant you foresight. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to be granted foresight.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Jastev, causing pale silver and grey light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing pale silver and grey light to momentarily coalesce in front of him. &amp;lt;section end=Jastev chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Kai to bless you with strength and endurance.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to be blessed with strength and endurance.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Kai, causing steely silver and crimson light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing steely silver and crimson light to momentarily coalesce in front of him. &amp;lt;section end=Kai chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for justice to be served by Koar&#039;s hand.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for justice to be served.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Koar, causing golden and white light to momentarily coalesce in front of you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing golden and white light to momentarily coalesce in front of him.&amp;lt;section end=Koar chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for death and rebirth to grace the world through Lorminstra&#039;s will.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for death and rebirth to grace the world.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Lorminstra, causing pure golden and black light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing pure golden and black light to momentarily coalesce in front of her.&amp;lt;section end=Lorminstra chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Lumnis for wisdom and guidance.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for wisdom and guidance.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Lumnis, causing multihued and golden light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing multihued and golden light to momentarily coalesce in front of her. &amp;lt;section end=Lumnis chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Oleani for love to bloom.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for love to bloom.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Oleani, causing vibrant red and pale pink light to momentarily coalesce in front of you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing vibrant red and pale pink light to momentarily coalesce in front of her.&amp;lt;section end=Oleani chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Phoen for the sun to rise again soon.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the sun to rise again soon.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Phoen, causing bright golden and blue light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing bright golden and blue light to momentarily coalesce in front of her.&amp;lt;section end=Phoen chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Ronan to grant you a peaceful sleep.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to be granted a peaceful sleep.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Ronan, causing night black and silver light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing night black and silver light to momentarily coalesce in front of her. &amp;lt;section end=Ronan chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Tonis to bless you with swiftness of foot and deed.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to be blessed with swiftness of foot and deed.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Tonis, causing golden and pale blue light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing golden and pale blue light to momentarily coalesce in front of him. &amp;lt;section end=Tonis chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Pantheon of Lornon===&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Andelas for a successful hunt.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for a successful hunt.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Andelas, causing blood red and black light to momentarily coalesce in front of you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing blood red and black light to momentarily coalesce in front of him.&amp;lt;section end=Andelas chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Eorgina to bend your will and purpose to Her own devices.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to be used as his patron commands.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Eorgina, causing fiery red and light grey light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing fiery red and light grey light to momentarily coalesce in front of her.&amp;lt;section end=Eorgina chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for arcane knowledge to be revealed through the will of Fash&#039;lo&#039;nae.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for arcane knowledge to be revealed.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Fash&#039;lo&#039;nae, causing golden yellow and silvery grey light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing golden yellow and silvery grey light to momentarily coalesce in front of him.&amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Ivas to empassion you and to fulfill your desires.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to be empassioned and have her desires fulfilled.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Ivas, causing jade green and ruddy red light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing jade green and ruddy red light to momentarily coalesce in front of her.&amp;lt;section end=Ivas chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for death and eternal servitude to come to your enemies by Luukos&#039; hand.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for death and eternal servitude to come to her enemies.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Luukos, causing emerald green and bronze light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing emerald green and bronze light to momentarily coalesce in front of him.&amp;lt;section end=Luukos chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for complete destruction to manifest by Marlu&#039;s hand.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for complete destruction.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Marlu, causing flat black and dark grey light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing flat black and dark grey light to momentarily coalesce in front of her.&amp;lt;section end=Marlu chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking to know the touch of pain through Mularos&#039; will.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to know the touch of pain.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Mularos, causing misty white and incarnadine light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing misty white and incarnadine light to momentarily coalesce in front of him.&amp;lt;section end=Mularos chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Sheru for terror to grip all those touched by the night.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for terror to grip all those touched by the night.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Sheru, causing deep crimson and nightmare black light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing deep crimson and nightmare black light to momentarily coalesce in front of her.&amp;lt;section end=Sheru chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking V&#039;tull to bring war to the world and bloodlust to its people.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for war to be brought to the world and bloodlust to its people.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to V&#039;tull, causing red-lined black and crimson light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing red-lined black and crimson light to momentarily coalesce in front of her.&amp;lt;section end=V&amp;amp;#39;tull chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Pantheon of Neutrality===&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Gosaena for the serenity that comes with the acceptance of fate.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the serenity that comes with the acceptance of fate.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Gosaena, causing silver and green light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing silver and green light to momentarily coalesce in front of her. &amp;lt;section end=Gosaena chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Zelia for the moons to guide the way to purity of mind.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the moons to guide the way to purity of mind.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Zelia, causing bright silver and muted black light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing bright silver and muted black light to momentarily coalesce in front of him. &amp;lt;section end=Zelia chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Lesser Spirits===&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for the earth and gardens to prosper through Aeia&#039;s will.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the earth and gardens to prosper.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Aeia, causing white and green light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing white and green light to momentarily coalesce in front of him.&amp;lt;section end=Aeia chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Amasalen to consecrate your coming sacrifice &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking his coming sacrifice to be consecrated.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Amasalen, causing purple and crimson light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing purple and crimson light to momentarily coalesce in front of her.&amp;lt;section end=Amasalen chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for your enemies to be betrayed by Arachne&#039;s will.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for his enemies to be betrayed.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Arachne, causing glossy black and sanguine light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing glossy black and sanguine light to momentarily coalesce in front of her&amp;lt;section end=Arachne chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for the power of deception with which to intimidate and subvert all to the will of Ghezresh.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the intimidating power that is deception. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; &amp;lt;section end=Ghezresh chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking The Huntress to deliver rightful vengeance upon the deserving.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to have rightful vengeance delivered upon the deserving.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to The Huntress, causing intense silver and glossy black light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing intense silver and glossy black light to momentarily coalesce in front of her.&amp;lt;section end=The Huntress chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Jaston for the blessing of the winds.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for the blessing of the winds.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Jaston, causing white and green light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing white and green light to momentarily coalesce in front of him.&amp;lt;section end=Jaston chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for herbs and flowers to flourish by Kuon&#039;s will.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for herbs and flowers to flourish.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Kuon, causing gold and brown light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing gold and brown light to momentarily coalesce in front of her.&amp;lt;section end=Kuon chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for lost love to be healed by Laethe&#039;s hand.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for lost love to be healed.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Laethe, causing black and purple light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing black and purple light to momentarily coalesce in front of her.&amp;lt;section end=Laethe chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Leya to lend Her strength and temperance to your cause.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking to be given strength and temperance&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Leya, causing ivory white and deep blue light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing ivory white and deep blue light to momentarily coalesce in front of her. &amp;lt;section end=Leya chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Niima for favorable tides.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for favorable tides.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Niima, causing silvery grey and blue-green light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing silvery grey and blue-green light to momentarily coalesce in front of her.&amp;lt;section end=Niima chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Onar for aid to deliver a quick and silent death.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for aid to deliver a quick and silent death. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Onar, causing bone white and dull black light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing bone white and dull black light to momentarily coalesce in front of him.&amp;lt;section end=Onar chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for skill and song to grace you by the talent of Tilamaire&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for skill and song to grace him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Tilamaire, causing yellow and blue light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing yellow and blue light to momentarily coalesce in front of him.&amp;lt;section end=Tilamaire chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking Voaris for forbidden love to blossom.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for forbidden love to blossom.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Voaris, causing vibrant yellow and red light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing vibrant yellow and red light to momentarily coalesce in front of her.&amp;lt;section end=Voaris chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for unjustly bound souls to be released by Voln&#039;s will&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison, asking for unjustly bound souls to be released.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to Voln, causing bright white and muted black light to momentarily coalesce in front of you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows his head and chants a short prayer, causing bright white and muted black light to momentarily coalesce in front of him. &amp;lt;section end=Voln chant /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Unaligned===&lt;br /&gt;
;Other &amp;lt;section begin=Other chant /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p cleric]}}&#039;&#039;&#039; You chant a reverent orison, asking for the blessing of your patron.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p cleric]}}&#039;&#039;&#039; CLERIC chants a short but reverent orison to his patron.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p paladin]}}&#039;&#039;&#039; You bow your head and chant a short prayer to your deity, causing grey and silver light to momentarily coalesce in front of you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p paladin]}}&#039;&#039;&#039; PALADIN bows her head and chants a short prayer, causing grey and silver light to momentarily coalesce in front of her. &amp;lt;section end=Other chant /&amp;gt; &lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Major Sanctuary (220)]] ==&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
===== Charl ===== &lt;br /&gt;
&amp;lt;section begin=Charl 220 /&amp;gt;&lt;br /&gt;
:Whipping winds carry the hot, metallic taste of lightning to you as your surroundings blur...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Eye of the Storm Sanctuary&lt;br /&gt;
|desc=Protected within the eye of the storm, the waters of the grey chamber lap gently at your feet. Beyond the calm and quiet of the sanctuary is a raging hurricane of whipping winds and lightning streaked skies. Directly above, the sky is clear and the quiet sounds of a gull drift to your ears.}}&lt;br /&gt;
:The blinding flash of lightning shatters the chamber in a cloud of wind and light, causing it to dissolve around you... &amp;lt;section end=Charl 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Cholen ===== &lt;br /&gt;
&amp;lt;section begin=Cholen 220 /&amp;gt;&lt;br /&gt;
:Bright colors swirl and dance around you, obscuring your vision...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary of Laughter&lt;br /&gt;
|desc=Vibrant swathes of fabric fall from a peaked ceiling to pool on mutli-hued floors of overlapping woven silk rugs. The fabric ripples with the heavily incense-scented wind, while candlelight beyond the fabric walls casts the silhouette of jugglers, acrobats, and dancers. Laughter fills the air and lifts the spirits.}}&lt;br /&gt;
:&#039;&#039;&#039;(missing end messaging)&#039;&#039;&#039; &amp;lt;section end=Cholen 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Eonak =====&lt;br /&gt;
&amp;lt;section begin=Eonak 220 /&amp;gt;&lt;br /&gt;
:A sudden rush of heat blasts your face, causing your eyes to water. Your vision blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=The Forge Sanctuary&lt;br /&gt;
|desc=Large brown blocks form the high walls of the stall, while the ground is fashioned of packed dirt. Burning strongly in a walled pit is a sweat inducing heat with a bright orange glow. The faint clang of a hammer striking an anvil rises and falls upon the air.}}&lt;br /&gt;
:The flames rise suddenly as a wayward breeze stirs the fire&#039;s ashes. Sweat trickles into your eyes and obscures your vision of the world around you... &amp;lt;section end=Eonak 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Imaera =====&lt;br /&gt;
&amp;lt;section begin=Imaera 220 /&amp;gt;&lt;br /&gt;
:Crisp and richly scented, a cool wind encircles you while a swirl of crimson, golden, and brown leaves obscures your vision...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary of Autumn&#039;s Embrace&lt;br /&gt;
|desc=Oak and maple rise around a field of half-harvested golden wheat, their limbs festooned with the vibrant hues of autumn leaves. Bundles of grain create circular seats throughout the field and form a loose ring around a large doe crafted of straw and decorated with bunches of hydrangea. The quiet chirp of birds creates a soft, lazy song on the rich, earth scented air.}}&lt;br /&gt;
:Dozens of autumn leaves fall from their sturdy boughs and obscure your vision of the world around you... &amp;lt;section end=Imaera 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Jastev =====&lt;br /&gt;
&amp;lt;section begin=Jastev 220 /&amp;gt;&lt;br /&gt;
:Somber grey mist clings to your hands and face as it obscures your vision of the world around you...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=The Artist&#039;s Sanctuary&lt;br /&gt;
|desc=Multi-hued specks of paint create abstract patterns upon the grey marble floor, which leads into the smooth curve of glass walls. The ceiling is shrouded in grey mist, and images beyond the translucent walls move in a panoramic view depicting your life from birth to now. Light shifts and swirls around you, but the ever aging view of life trickles past.}}&lt;br /&gt;
:Descending from the ceiling, the somber grey mist encompasses you and obscures your vision just as the future begins to unfold on the sanctuary&#039;s walls. Slowly, your world dissolves... &amp;lt;section end=Jastev 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Kai =====&lt;br /&gt;
&amp;lt;section begin=Kai 220 /&amp;gt;&lt;br /&gt;
:The sound of battle cries and war horns reaches your ears, and your vision is blurred with the images of battles being fought in countless places.  You feel the world around you shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary of the Hero&#039;s Hearth|&lt;br /&gt;
desc=Thick and brown, a rich bear rug offers soft comfort before a fireplace set with a roaring flame.  Arranged around the crimson walled room are a multitude of weapons, armor, and shields; the silver metal they are crafted of reflects the light of the fire.  Resting upon the mantle is a single gauntlet fashioned of metallic scales and formed into a clenched fist.}}&lt;br /&gt;
:The distant cry of horns calls to you as the world around you dissolves into a blur of crimson and silver light...&amp;lt;section end=Kai 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Koar =====&lt;br /&gt;
&amp;lt;section begin=Koar 220 /&amp;gt;&lt;br /&gt;
:Warm and richly scented, the air around you shifts and your vision is filled with an emerald light...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Heart of the World Sanctuary&lt;br /&gt;
|desc=Emerald veins brighten the dark stone walls and trace a spindly path to the roof, which is riddled with stalactites. A soft sound echoes through the vast cavern as condensation drips from the ceiling to join with the mineral pools that speckle the landscape. Rising and falling as if from a mighty breath, the air sighs through the chamber and you are filled with the presence of antiquity.}}&lt;br /&gt;
:A single drop falls from a nearby stalactite, your vision captivated by its descent. As it enters the mineral pool at your feet your vision explodes and the world around you dissolves... &amp;lt;section end=Koar 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Lorminstra =====&lt;br /&gt;
&amp;lt;section begin=Lorminstra 220 /&amp;gt;&lt;br /&gt;
:A shiver of wind touches your breath and you feel your eyelashes grow thick with a coating of snow. You lift your eyes to the sky and white blurs your vision...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Winter&#039;s Sanctuary&lt;br /&gt;
|desc=Pines and evergreens form a loose circle around the snow-swept glade, their branches heavy with frost and icicles. Onyx marble benches with legs carved in the bas-relief image of funeral processions provide a sharp contrast to the white landscape. A chill wind speckled with snowflakes swirls past. A smattering of iceblossoms at the heart of the sanctuary lends the air a light, sweet fragrance.}}&lt;br /&gt;
:Rising suddenly, the chill air sends a flurry of snow towards you and your vision swims with white flakes... &amp;lt;section end=Lorminstra 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Lumnis =====&lt;br /&gt;
&amp;lt;section begin=Lumnis 220 /&amp;gt;&lt;br /&gt;
:Bright light rises around you and your world blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Solace of Knowledge Sanctuary&lt;br /&gt;
|desc=Clinging to ivory columns, wisteria and grape vines twine to obscure the peaked marble roof, their sweet fragrance filling the air. Bright light, its source unseen yet constant, fills the quiet space around a small, square pool filled with lilies and koi. Concentric bands of white, black, blue, red, and green overlap each other and enclose solitary meditation mats while pale drapes flutter lightly in a soft breeze.}}&lt;br /&gt;
:Each pulsing in a color of its own, the concentric bands inlaid into the floor grow brighter and brighter until your vision is filled with them and the world around you is blurred... &amp;lt;section end=Lumnis 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Oleani =====&lt;br /&gt;
&amp;lt;section begin=Oleani 220 /&amp;gt;&lt;br /&gt;
:Scented with the heady aroma of roses mixed with sweet wildflowers, the wind stirs around you and the world blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Care of the Mother Sanctuary&lt;br /&gt;
|desc=Sunlight streams through stained glass panes of a bright red heart with a white rose blooming from its center, creating a mirror image upon the polished white marble floor. Cushioned pallets, downy soft and fluffy for comfort, are spaced sporadically about the sanctuary. The delicate trill of a reed flute twines with a harp in a playful duet somewhere nearby. Tiny fonts of rose quartz burble quietly beneath the painted window, their cool waters comforting and inviting.}}&lt;br /&gt;
:A deep sense of peace fills you as the world around you blurs... &amp;lt;section end=Oleani 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Phoen =====&lt;br /&gt;
&amp;lt;section begin=Phoen 220 /&amp;gt;&lt;br /&gt;
:Hot, yet comforting, a warm summer wind swirls around you and blurs your vision with a glittering light...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Summer Solace Sanctuary&lt;br /&gt;
|desc=Soft, rich green grass spreads from horizon to horizon beneath a pale blue sky, while a golden sun burns brightly in the heavens. Sparrows flit through the meadow at play, their melodic warble soothing as it fills the air.}}&lt;br /&gt;
:Tiny filaments of golden light sparkle around you, obscuring your vision. As the remnants of a summer breeze brush your cheeks, the world around you dissolves... &amp;lt;section end=Phoen 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Ronan =====&lt;br /&gt;
&amp;lt;section begin=Ronan 220 /&amp;gt;&lt;br /&gt;
:Saturated with the soothing scent of jasmine, a lazy breeze caresses your face, blurring your vision and the surroundings...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Star Spangled Sanctuary&lt;br /&gt;
|desc=Thousands of silvery pinpoints of light are scattered across the sanctuary&#039;s sky, which is colored so deep a blue that it is nearly black. Chilled marble, polished to a reflective sheen, reflects the night sky and is covered with downy soft sleeping pallets. The sound of a soft lullaby, its words unintelligible but its tune somehow familiar, drifts to your ears on the lazy wind.}}&lt;br /&gt;
:Above you the heavens swirl and stir, their distant brightness growing as the stars fall from the sky and speed towards you, causing your vision, and the sanctuary, to blur... &amp;lt;section end=Ronan 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Tonis =====&lt;br /&gt;
&amp;lt;section begin=Tonis 220 /&amp;gt;&lt;br /&gt;
:Winds swirl and whip around you, obscuring your vision and causing the world to blur...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Aerial Stable Sanctuary&lt;br /&gt;
|desc=Gold-veined azure marble forms sturdy columns that support a white marble roof, which is peaked and decorated with golden equestrian symbols. Neatly divided stables range from either side of you and windows gaze out upon puffy white clouds and a crystal clear sky. The distant sound of neighing rises and falls on hay-scented air.}}&lt;br /&gt;
:Rising from a distant column, a golden pegasus comes to life and swiftly races onward. The white feathers of its wings flutter before your eyes and blur your vision... &amp;lt;section end=Tonis 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
===== Andelas =====&lt;br /&gt;
&amp;lt;section begin=Andelas 220 /&amp;gt;&lt;br /&gt;
:You hear a low purr as the scene before you turns to amorphous shapes of warm color, then it all blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Feline Sanctuary&lt;br /&gt;
|desc=Hot and well lit, the tree-bound platform stands high above the forest floor. Sunlight slants across the rough planks and a cool breeze rustles the nearby leaves. The sound of a prowling jaguar rises from the floor below, but is quickly quelled by an answering purr.}}&lt;br /&gt;
:The world around you narrows, and a feeling of lassitude fills you... &amp;lt;section end=Andelas 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Eorgina =====&lt;br /&gt;
&amp;lt;section begin=Eorgina 220 /&amp;gt;&lt;br /&gt;
:Silver light sparkles on the air, which suddenly turns cold and draws with it an unyielding wind. The light fills your vision...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Queen&#039;s Throne Room Sanctuary&lt;br /&gt;
|desc=Tall and imposing, an ornate throne rises at the distant end of the room upon a dais fashioned of sanguine-veined ebon marble. Moonlight streams in through floor-to-ceiling windows covered in silk sheers that flutter in a cool breeze, offering a glimpse of snow covered peaks beyond. A pair of golden candelabras spread their filigreed arms toward the distant ceiling and provides soft illumination for all under their glow.}}&lt;br /&gt;
:A sudden chill wind sets the sanguine silks covering the windows aflutter, their gauzy layers obscuring your vision... &amp;lt;section end=Eorgina 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Fash&#039;lo&#039;nae =====&lt;br /&gt;
&amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 220 /&amp;gt;&lt;br /&gt;
:The scene before you is turned aside as if it were merely drawn upon a cracked page in an old tome. The world around you shifts...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Library Sanctuary&lt;br /&gt;
|desc=Cramped shelves rise on all sides, their dusty expanses riddled with books of all sizes and shapes. Carefully shielded lanterns offer dim illumination for a space crowded with antique scrolls, tomes, and leather rolls. Dusty tables covered with maps, odd trinkets, and yellowed diagrams leave little floor space. A topaz eye with a deep ebon slit is painted into the ceiling, which houses hundreds of cobwebs.}}&lt;br /&gt;
:The shelves around you buckle, causing dozens of scrolls to fall upon you as the world around you shifts... &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Ivas =====&lt;br /&gt;
&amp;lt;section begin=Ivas 220 /&amp;gt;&lt;br /&gt;
:Your senses become flooded by a rush of perfumed smoke, and you are washed in a wave of jade-hued steam as the world around you blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Bathhouse Sanctuary&lt;br /&gt;
|desc=Plumes of roiling steam rise from the square pool occupying the center of this open air room. Walls purposefully half-finished rise like jagged teeth against the sky, unjoined and without a ceiling to offer both a view of the sky and of the surrounding wood around the bath. Brass spouts trickle water, and small burners allow the cloying scent of tuberose incense to perfume the air. In patches of jewel pigments, murals adorn the walls of the bath, the figures oddly distorted beneath the rippling water.}}&lt;br /&gt;
:Behind the sweet fragrance of tuberose, a scent more putrid lingers, tickling at your nose. As if emerging from a cloud of scalding steam, the air burns cold on your cheeks as your vision blurs to obscure the world around you... &amp;lt;section end=Ivas 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Luukos =====&lt;br /&gt;
&amp;lt;section begin=Luukos 220 /&amp;gt;&lt;br /&gt;
:Your ears are filled with a soft hiss as the world around you shifts...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Underground Sanctuary&lt;br /&gt;
|desc=Sharp stalactites hang from a ceiling riddled with shards of raw emerald, which reflects light throughout the cavern and casts everything in a greenish glow. Shattered and broken, an enormous serpentine mask of copper crawls with lines of verdigris as it sits in pieces on the edge of a small pool. The sound of slithering rises and falls at odd intervals and is randomly punctuated with a soft hiss.}}&lt;br /&gt;
:Yellowed eyes suddenly flash within the broken mask and your vision suddenly blurs... &amp;lt;section end=Luukos 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Marlu =====&lt;br /&gt;
&amp;lt;section begin=Marlu 220 /&amp;gt;&lt;br /&gt;
:The vision of your world is ripped harshly from your eyes and you are plunged into sudden darkness...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Crater of Destruction Sanctuary&lt;br /&gt;
|desc=Ragged at the edges, the crater rises on all sides like an enormous wound blasted into the soft belly of the earth beneath you. A hot, scorching wind riddled with grit, sand, and gravel procedes lightning, which streaks across the gloomy sky to briefly illuminate the desolate landscape.}}&lt;br /&gt;
:Lightning flashes before your eyes, turning your vision to an off-white that blurs... &amp;lt;section end=Marlu 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Mularos =====&lt;br /&gt;
&amp;lt;section begin=Mularos 220 /&amp;gt;&lt;br /&gt;
:Your senses become flooded with the sweet scent of roses, and you feel a sharp prickling against your palms as the world around you blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary of Thorns&lt;br /&gt;
|desc=Thick and lavish, the scent of roses permeates the air; the sweet breath of countless crimson blossoms adorn the bushes enclosing this small square garden. In each corner, an ivory pillar stands - from one, a pair of chained manacles dangle, from another, a pair of whips hang lifeless from gilded hooks. A thorn vine-carved chaise lounge sits in one of the unused corners, while a simple pedestal stands before the remaining pillar supporting a concave bowl of water littered with rose petals.}}&lt;br /&gt;
:Splashes of crimson paint your vision, and a breathy murmur lingers in your ears as your vision blurs, obscuring the world around you... &amp;lt;section end=Mularos 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Sheru =====&lt;br /&gt;
&amp;lt;section begin=Sheru 220 /&amp;gt;&lt;br /&gt;
:You hear a strange, haunting laughter echo around you as your vision blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Nightmare&#039;s Sanctuary&lt;br /&gt;
|desc=Dark shadows dance across the walls of the sanguine room in a macabre parade of twisted limbs and haunting sounds. Ebon drapes flutter in an unfelt wind across the spindled limbs of a four-poster bed that rests beside an open window; its shutters sporadically bang against the glass panes. A figure, swaddled in darkness, lies in the gloomy confines of the bed and thrashes at odd intervals.}}&lt;br /&gt;
:Shadows separate from the wall and surge towards you moments before your vision and the world around you blurs... &amp;lt;section end=Sheru 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== V&#039;tull =====&lt;br /&gt;
&amp;lt;section begin=V&amp;amp;#39;tull 220 /&amp;gt;&lt;br /&gt;
:Your senses are overwhelmed with the sound of war chants and the cry of pit fighters as the world around you blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Gladiator&#039;s Cell Sanctuary&lt;br /&gt;
|desc=Stone benches lay in a scattered arrangement upon a dusty floor, and the acrid scent of blood, sweat, and leather fills your nostrils. The sounds of men fighting, lions roaring, and the distant cry of the crowd filter down a narrow corridor set to one side. Painted high above on the red clay ceiling is the image of a black scimitar.}}&lt;br /&gt;
:Moving down the corridor, the sound of the waiting crowd floods your senses and the brightness of the light after the dimness of the sanctuary momentarily blinds you... &amp;lt;section end=V&amp;amp;#39;tull 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
===== Gosaena =====&lt;br /&gt;
&amp;lt;section begin=Gosaena 220 /&amp;gt;&lt;br /&gt;
:The world around you is swallowed in silence and a cascade of feathers obscures your vision...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary of Final Embrace&lt;br /&gt;
|desc=Moss green marble walls rise from black-veined white floor tiles only to disappear in the shrouded darkness of the ceiling. Solace fills you in the deep silence of the sanctuary, while a slight breeze carries the odd feather past you. A faint luminescent light glows from somewhere nearby, its source unseen.}}&lt;br /&gt;
:Pale light floods your vision as all around you turns to black and the world dissolves... &amp;lt;section end=Gosaena 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Zelia =====&lt;br /&gt;
&amp;lt;section begin=Zelia 220 /&amp;gt;&lt;br /&gt;
:Rolling chaotic winds filled with insane laughter swirl around you and your surroundings blur for a moment...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Shifting Sanctuary&lt;br /&gt;
|desc=Shifting sands move against the silvery, transparent walls of the chamber upon a chaotic wind riddled with laughter. Whispered questions, nonsensical and indefinable, echo around you and punctuate the objects that rise and fall in the landscape beyond the chamber. Painted tiles, seen and then unseen, decorate the floor and display a plethora of frozen faces locked in as many emotions.}}&lt;br /&gt;
:Silver light filters down through the chamber and laughter rises to drown you in its chaotic embrace as the world around you slowly fades away... &amp;lt;section end=Zelia 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
===== Aeia =====&lt;br /&gt;
&amp;lt;section begin=Aeia 220 /&amp;gt;&lt;br /&gt;
:Your senses become flooded with the scent of fresh, clean water and the heady fragrance of lilies as the world around you blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Garden Sanctuary&lt;br /&gt;
|desc=Surrounded on all sides by crystal clear spring water, the garden sanctuary is verdant and filled with life. Butterflies dance beneath a perpetual sun and alit upon dark violet butterfly weeds, which sway gently in a breeze scented with lilies and the distant sea. Stone benches are arranged around pockets of fiery violets, flaeshorn blooms, and pink petunias, while enormous white water lilies rest upon equally large green pads in the soothing waters.}}&lt;br /&gt;
:Green light floods your vision, obscuring the sanctuary and causing it to dissolve around you... &amp;lt;section end=Aeia 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Amasalen =====&lt;br /&gt;
&amp;lt;section begin=Amasalen 220 /&amp;gt;&lt;br /&gt;
:The taste of blood fills your mouth as your vision blurs in a wash of red, causing the world around you to disappear...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary of Blood&lt;br /&gt;
|desc=Dark and cloudless, the night sky spreads before you, punctuated by the soft glow of torches set at even intervals down several steep steps that disappear into a distant, dark jungle. Carved sigils ring a basin at the center of the sanctuary, its lip edged in razor-sharp obsidian that glistens with a thick, red liquid. A two-headed snake slithers around a severed hand painted crimson with its own blood at the edge of the sanctuary&#039;s platform.}}&lt;br /&gt;
:Hissing suddenly, the twin heads of the serpent suddenly strike out towards you and your vision blurs with crimson light... &amp;lt;section end=Amasalen 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Arachne =====&lt;br /&gt;
&amp;lt;section begin=Arachne 220 /&amp;gt;&lt;br /&gt;
:Skeins of silver light swirl around, wrapping you in a cool cocoon that obscures the world around you...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Spiderweb Sanctuary&lt;br /&gt;
|desc=Cradled in a soft hammock, the sanctuary&#039;s floor is fashioned of dozens upon dozens of silver skeins of spider webbing. Eight trees, blurred by distance, ring the web and provide anchor points to the tightly woven aerial floor, which sways gently in a light breeze. A crimson sky remains unchanged and the distant ground is lost in ebon shadows.}}&lt;br /&gt;
:Crimson light obscures your vision as the sanctuary around you dissolves away... &amp;lt;section end=Arachne 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Ghezresh =====&lt;br /&gt;
&amp;lt;section begin=Ghezresh 220 /&amp;gt;&lt;br /&gt;
:Issuing the last syllables of the spell, your vision blurs with a silvery grey light, and the world around you shifts...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Under The Sea&lt;br /&gt;
|desc=Basalt rocks, slick and ragged, rise from a sand-ravaged ground littered with tangled clusters of lifeless kelp and seagrass. Beyond the surrounding bubble of air is a murky ocean filled with imposing shadows from large aquatic beasts that pass just out of sight. The acrid scent of the sea assaults your senses, and you sense that at any moment, the bubble could pop, and water could come rushing in.}}&lt;br /&gt;
:Indigo light floods your vision, and you feel the waters come rushing towards you, the weight of their presence intimidating and imposing. Just as you sense that this breath may be your last, the world around you dissolves...&amp;lt;section end=Ghezresh 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== The Huntress =====&lt;br /&gt;
&amp;lt;section begin=The Huntress 220 /&amp;gt;&lt;br /&gt;
:The blast of a horn rises on the air and your vision is suddenly obscured by rapid movement that you can&#039;t pinpoint...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary of the Hunt&lt;br /&gt;
|desc=Tall and imposing, aspen and modwir trees form a thick ring around a clearing covered in knee-high grass. Positioned before a babbling brook is a black willow tree glossy with strange signs of petrification. Carved into the now nearly crystalline bark are various scenes of the wild hunt, together forming a circle about an eight-pointed star.}}&lt;br /&gt;
:Three short blasts of a horn make the trees around you vibrate and their leaves fall upon you in a cascade of color that obscures your vision... &amp;lt;section end=The Huntress 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Jaston =====&lt;br /&gt;
&amp;lt;section begin=Jaston 220 /&amp;gt;&lt;br /&gt;
:The air swirls around you, causing your feet to lose contact with the ground and your vision swims in a world of soft white...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Aviary Sanctuary&lt;br /&gt;
|desc=Polished golden wire creates an open-weave latticework ceiling supported by white pillars.  Golden ivy swirls around each support, and at various intervals stretches across to create small swings and perches for the hundreds of bright birds.  Canaries, sparrows, finches, and doves mingle with toucans and cockatoos in the high reaches of the sanctuary, while the cool marble floor supports wandering peacocks and whippoorwills.}}&lt;br /&gt;
:All at once every bird in the sanctuary takes wing and your vision is flooded with their bright colors and loud caws... &amp;lt;section end=Jaston 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Kuon =====&lt;br /&gt;
&amp;lt;section begin=Kuon 220 /&amp;gt;&lt;br /&gt;
:The rich, earthy scent of herbs fills your senses as your vision blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Healer&#039;s Sanctuary&lt;br /&gt;
|desc=Wind ruffles the sides of the off-white canvas walls, which fall in gentle pleats from the peaked roof to the short and tall blades of the grass. Potted healing plants are arranged in every available space of the tent from shelves to corners to the area where the walls meet the ground. A series of empty cots are arranged in alternating patterns with wooden stools near the central support pole, and several brass lanterns shed golden light upon the area.}}&lt;br /&gt;
:Cool breezes tug the walls of the tent free from their supports and they sway before your eyes in a blur of white... &amp;lt;section end=Kuon 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Laethe =====&lt;br /&gt;
&amp;lt;section begin=Laethe 220 /&amp;gt;&lt;br /&gt;
:A cloud of black rose petals rises from the ground and swirls across your vision...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Widow&#039;s Walk Sanctuary&lt;br /&gt;
|desc=Surrounding the flat widow&#039;s walk deck is a wrought iron balustrade, beyond which lie bright orange terracotta shingles. Hundreds of deep purple glass votives house tiny candles that burn fitfully in the light zephyr that gently tugs at you. Clouds blanket the sky, their fluffy faces painted rosy and amethyst by the perpetual twilight.}}&lt;br /&gt;
:Black rose petals rise from the ground to swirl about you, their heady fragrance momentarily stuns you, and your vision blurs... &amp;lt;section end=Laethe 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Leya =====&lt;br /&gt;
&amp;lt;section begin=Leya 220 /&amp;gt;&lt;br /&gt;
:Your senses become flooded with the distinct sound of an owl&#039;s cry, and the faint, fleeting scent of trillium as the world around you blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Glade Sanctuary&lt;br /&gt;
|desc=Tall marble columns inlaid with lapis daggers enclose a well-used sparring ring, its center bare of the grass that emerges green only near the edge. Against the ivory hue of the pillars, trillium blossoms blend to near invisibility, distinguished only by dark verdant foliage and a scent that haunts the air like a waking dream. Set back from the grounds, statues look in from each of the cardinal points, characterized by remarkable craftsmanship; in front of each is a small pool of crystalline water.}}&lt;br /&gt;
:Azure sparks of light flood your vision, obscuring the sanctuary and causing it to dissolve around you... &amp;lt;section end=Leya 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Niima =====&lt;br /&gt;
&amp;lt;section begin=Niima 220 /&amp;gt;&lt;br /&gt;
:Cool azure light bathes you as your surroundings blur for a moment...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Aquatic Sanctuary&lt;br /&gt;
|desc=Tranquil and serene, the chamber echoes with faint aquatic sounds. Water laps unobtrusively at your feet, its presence warm and comforting. The chamber&#039;s curved walls and ceiling are translucent and beyond them the presence of sea creatures, both large and small, can be noted drifting by.}}&lt;br /&gt;
:Golden flecks of light pervade the azure depths of the sanctuary and with an audible pop, the world around you slowly fades.. &amp;lt;section end=Niima 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Onar =====&lt;br /&gt;
&amp;lt;section begin=Onar 220 /&amp;gt;&lt;br /&gt;
:A deep shadow descends upon you and your breath is briefly muffled as your your vision blurs with darkness...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Obsidian Shadow Sanctuary&lt;br /&gt;
|desc=Obsidian walls rise from smooth black marble floors into a doomed ceiling shrouded in darkness. Set within a tiered structure, dozens of bone white tallows are arranged in the semblance of a cracked skull. Each short wick burns slow, causing them to splutter sporadically with any nearby movement; the candles&#039; illumination is not enough to dispel the shadows beyond their ring of light. A velvet silence fills the air.}}&lt;br /&gt;
:Suddenly the candles at the heart of the room go out and you are plunged into a deep darkness that obscures your vision of the world around you... &amp;lt;section end=Onar 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Tilamaire =====&lt;br /&gt;
&amp;lt;section begin=Tilamaire 220 /&amp;gt;&lt;br /&gt;
:Lively music fills the air and is accompanied by merry laughter. Your vision suddenly blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Inspiration&#039;s Sanctuary&lt;br /&gt;
|desc=Bright blue walls are covered with pictures of inspiring landscapes, stunning flowers, vibrant festivals, and beautiful faces; each is tacked in place by golden musical note-shaped stickpins. Resting beside the oak door is a worn traveler&#039;s cloak, threadbare and patched, a rustic carryall, and a weather-friendly instrument. A writing table with musical sheets, inkpots, and quills stored upon it is set beneath a sunlit window. Music fills the air with its sweet lively cadence.}}&lt;br /&gt;
:Blue light swirls before your eyes and the tempo of the song changes to an old, whistled traveling tune. As the tune begins to fade, the world around you blurs... &amp;lt;section end=Tilamaire 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Voaris =====&lt;br /&gt;
&amp;lt;section begin=Voaris 220 /&amp;gt;&lt;br /&gt;
:Your vision swims with the glittering glow of candlelight...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Chapel Sanctuary&lt;br /&gt;
|desc=Smooth marble walls shimmer with the golden flicker of candlelight from dozens of white pillar candles set in golden candelabras throughout the small chapel. Three steps rise to a small altar covered with a yellow rose embroidered cloth. Laying upon the altar cloth is a small bowl, a slender handfasting cord, and a bouquet of yellow roses ringed with edelweiss.}}&lt;br /&gt;
:A murmured promise touches your ears seconds before the candlelight flickers out and your vision blurs... &amp;lt;section end=Voaris 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===== Voln =====&lt;br /&gt;
&amp;lt;section begin=Voln 220 /&amp;gt;&lt;br /&gt;
:The sound of a man softly praying fills your ears and your vision blurs...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Vigil Sanctuary&lt;br /&gt;
|desc=Austere and barren, the sanctuary is ringed in white walls devoid of any wall hangings or fixtures except for a single window cut in the shape of a shield. A lone prayer-mat, beaded with onyx and white birch, rests at the center of the small room, while one white pillar candle burns quietly near the narrow door.}}&lt;br /&gt;
:The candle flickers out and your vision is blanketed in velvety blackness... &amp;lt;section end=Voln 220 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
&lt;br /&gt;
===== Other =====&lt;br /&gt;
&amp;lt;section begin=Other 220 /&amp;gt;&lt;br /&gt;
:A swirling grey mist enshrouds you as your surroundings blur for a moment...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary&lt;br /&gt;
|desc=A grey, swirling mist surrounds you, its tendrils creeping around your feet and twisting into a thick, translucent mass that vaguely forms a curved wall around the chamber.  A feeling of calmness and protection passes over you as you sense that nothing harmful may pass the swirling walls.}}&lt;br /&gt;
:A grey mist erupts around you and your visions of sanctuary slowly fade...&amp;lt;section end=Other 220 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
=== Natural Sanctuaries ===&lt;br /&gt;
Major Sanctuary will allow unaligned characters to enter a natural sanctuary based on the spirits of the area they cast the spell in. However, if anyone, including aligned characters, wishes to enter a specific natural sanctuary, they can cast this spell while holding a [[runestone]] corresponding to the desired sanctuary (e.g. using a taiga runestone to get to the Taiga Sanctuary). An unaligned character is one that has no set deity per CONVERT and is not to be confused with being set to OTHER.&lt;br /&gt;
&lt;br /&gt;
;Alpine Sanctuary&lt;br /&gt;
You are bathed in a snow white light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Alpine Sanctuary&lt;br /&gt;
|desc=Gazing out from the granite ledge yields a view of snowy expanses and sparse evergreens that punctuate the white landscape.  Smooth stone rises on one side, while the rest of the sanctuary lays open to the cold mountain air.  Pale clouds, close enough that they can almost be touched, speckle the brilliant blue sky on a firm breeze that chills to the bone.}}&lt;br /&gt;
&lt;br /&gt;
;Astral Runestone&lt;br /&gt;
You are bathed in a silvery light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Astral Sanctuary&lt;br /&gt;
|desc=Dense white mist spreads across the floor, which is cooled with a slight breeze that brushes only a handspan above its wispy surface.  Unobstructed grey spreads across the sky, its expanse bleak and dull to the senses.  Strange, rhythmic thumping echoes through the air at even intervals and pulses with a steady, strong beat.}}&lt;br /&gt;
&lt;br /&gt;
;Aurora Runestone&lt;br /&gt;
You are bathed in an intense yellow light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Aurora Sanctuary&lt;br /&gt;
|desc=The purple sky dances with waves of rainbow lights, filling the heavens with their awe-inspiring illumination.  Bands of color swirl downward to touch the snow-capped mountains only to suddenly spike upward as they seek the sky.  A dry breeze drifts by carrying with it the bite of the arctic and a random snowflake.}}&lt;br /&gt;
&lt;br /&gt;
;Badland Runestone&lt;br /&gt;
You are bathed in a sandy tan light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Badland Sanctuary&lt;br /&gt;
|desc=High canyon walls are layered with bands of copper and reddish clay as they rise into a sky darkened by the approach of a purplish dusk.  Brittle bushes, which long ago gave up on life, tumble across the dusty ground and collect other twigs and vines to their girth.  A dry wind, laden with sand and heat, passes through the area, stealing moisture as it travels.}}&lt;br /&gt;
&lt;br /&gt;
;Bog Runestone&lt;br /&gt;
You are bathed in a sickly green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Bog Sanctuary&lt;br /&gt;
|desc=Long vines of kudzu cling to the trees, their leafy expanses add a shade of color to the already verdant landscape.  Here and there pockets of water, viridian and chocolate with long skeins of algae, speckle the land.  Downed trees stand at angles to their brothers like drunken comrades holding each other up.  A soft buzzing is punctuated by the strange sound of swamp gases popping and carries with it the distinct aroma of brimstone.}}&lt;br /&gt;
&lt;br /&gt;
;Boulder Runestone&lt;br /&gt;
You are bathed in an earthy brown light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Boulder Sanctuary&lt;br /&gt;
|desc=Dropping on all sides to twice again the height of a giant, the boulder rises high off the ground.  Smooth sides and surface space provide ample room for movement, while remaining open to the air above.  The landscape can be seen beyond, but is only dotted with a field of enormous rocks and dirt pathways.}}&lt;br /&gt;
&lt;br /&gt;
;Cavern Runestone&lt;br /&gt;
You are bathed in an earthy brown light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Cavern Sanctuary&lt;br /&gt;
|desc=Riddled with stalactites, the ceiling of the sanctuary is dark, and the walls are distant and riddled with veins of ore. A feeling of great weight fills the air, which is laden with the scent of metal and dirt; a sense of antiquity rises like dust from the smooth ground.}}&lt;br /&gt;
&lt;br /&gt;
;Celestial Runestone&lt;br /&gt;
You are bathed in a silvery light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Celestial Sanctuary&lt;br /&gt;
|desc=Dull and grey, craters riddle the landscape, which seems to go on in all directions for as far as the eye can see.  Sound is muted, and everything seems somehow softened by the tranquility of the sanctuary.  High above, the sky is riddled with hundreds of stars and interrupted in the distance by the strong, burning glows of Liabo and Lornon.}}&lt;br /&gt;
&lt;br /&gt;
;Crevasse Runestone&lt;br /&gt;
You are bathed in an earthy brown light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Crevasse Sanctuary&lt;br /&gt;
|desc=Twin stone walls, smooth and marked with waterlines from a river long since evaporated, rise high toward a peaked ceiling awash in tans and whites.  Dust descends in a fine rain around the boulders that rise to obstruct either end of the sanctuary.  A strand of light illuminates the area from a series of glowing mushrooms clustered between the wall and floor, their shine greenish and bright.}}&lt;br /&gt;
&lt;br /&gt;
;Desert Runestone&lt;br /&gt;
You are bathed in a sandy tan light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Desert Sanctuary&lt;br /&gt;
|desc=The walls of the sanctuary rise in a swirling vortex of beige light, sand, and dirt, and are in constant motion, sporadically blocking out the light of the sun above.  The howl of the winds is almost deafening, yet the ground remains smooth and calm.  Falling like snow, a fine rain of glittering gold sand sprinkles in calm contrast to the chaotic walls.}}&lt;br /&gt;
&lt;br /&gt;
;Dune Runestone&lt;br /&gt;
You are bathed in a sandy tan light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Dune Sanctuary&lt;br /&gt;
|desc=Rolling hills of golden sand sparkle in the silvery moonlight, their faces rippled with the pattern of a wind that tattooed the landscape with its ethereal tendrils.  Crickets sing a discordant song, while sparrows and finches rise from their daytime shelters into the cooling desert air.  A lone well, dusty and brown, rests at the heart of the sanctuary, its rope swaying back and forth in a hypnotic rhythm.}}&lt;br /&gt;
&lt;br /&gt;
;Forest Runestone&lt;br /&gt;
You are bathed in a forest green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Forest Sanctuary&lt;br /&gt;
|desc=Ringed on all sides by the protective embrace of enormous redwood trees, the sanctuary is filled with shafts of light and the lyrical song of a lark as it lazily drifts from bough to bough.  Soft moss carpets the ground and clings to the dark wood, though it climbs no higher than three hand-spans, and five-fingered leaves flutter on a wind that is light and cool.  A deep feeling of antiquity fills the air and is accented by the subtle groaning of the rooted giants.}}&lt;br /&gt;
&lt;br /&gt;
;Geyser Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Geyser Sanctuary&lt;br /&gt;
|desc=Centered within a ring of mineral pools, and rising from the ground like an enormous anthill, is a volcanic rock-ringed geyser.  The aqua blue waters bubble and churn as the vent prepares for another burst of sky high waters.  Deposits of iron, rhodocrosite, rhyolite, and spongy rock speckle the landscape, which glistens wetly in the ambient light.}}&lt;br /&gt;
&lt;br /&gt;
;Glacier Runestone&lt;br /&gt;
You are bathed in a snow white light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Glacier Sanctuary&lt;br /&gt;
|desc=Cupped in a bowl between mountain peaks, the glacier resembles a smooth, uncut aquamarine of enormous proportions.  Plump flakes drift downward on a chill breeze, their lazy movements accented by the hoarse call of the wind through the ragged stone.  Faint cracks and groans can be heard at random moments as the mountains and glacier converse in their own venerable tongue.}}&lt;br /&gt;
&lt;br /&gt;
;Island Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Island Sanctuary&lt;br /&gt;
|desc=Surrounded on all sides by water, the sanctuary is a small island of sand and beach grasses. A single pine tree reaches its verdant tendrils towards a sky that is sapphire blue and devoid of clouds. Crashing insistently against the white sands is the ebb and flow of the ocean, its passage creating a soothing breeze.}}&lt;br /&gt;
&lt;br /&gt;
;Lake Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Lake Sanctuary&lt;br /&gt;
|desc=The aquatic walls of the sanctuary glisten with phosphorescent filaments that illuminate the otherwise dark space with a light glow.  Water creeps between the rocks ringing the sanctuary and flows through the area in a sinuous pattern over smooth stones, its passage melodic and calming.  The air is heavy with a dampness that seeps to the bones and is nearly too chill to tolerate.}}&lt;br /&gt;
&lt;br /&gt;
;Lavaflow Runestone&lt;br /&gt;
You are bathed in a deep red light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Lavaflow Sanctuary&lt;br /&gt;
|desc=Molten lava, bright orange and fiery hot, surrounds the obsidian island on all sides as it swiftly flows past.  Tiny bubbles rise and pop along the surface and randomly spray the air with embers that twist and burn.  A searing heat radiates from the boiling river, though the heart of the sanctuary remains only warm.}}&lt;br /&gt;
&lt;br /&gt;
;Luck Runestone&lt;br /&gt;
You are bathed in rainbow light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Luck Sanctuary&lt;br /&gt;
|desc=Bands of color cut across the sanctuary and illuminate everything in their path with a powerful glow.  Reds transition to oranges, which become yellows in an arc that eventually melds into green, blue, and violet.  Beyond the edges of color, the world is void of light and hue, though it is filled with merry laughter and a sound like the clinking of countless coins cascading to the ground.}}&lt;br /&gt;
&lt;br /&gt;
;Marsh Runestone&lt;br /&gt;
You are bathed in a sickly green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Marsh Sanctuary&lt;br /&gt;
|desc=Twisted banyans rise from the stagnant waters that surround the small, dry island; their limbs spread wide until woven into a canopy of leaves and vines.  Thick mosses carpet the ground, creating an unnatural silence that is frequently punctuated by the tapping of a woodpecker.  A dark shape moves beneath the surface of the water, disrupting floating leaves and causing ripples to lap at the muddy shore.}}&lt;br /&gt;
&lt;br /&gt;
;Mountain Runestone&lt;br /&gt;
You are bathed in an earthy brown light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Mountain Sanctuary&lt;br /&gt;
|desc=Winds howl and gust beyond the opening of the sanctuary, which is a black hole of ragged stone and dangling tree roots.  Smooth walls taper as they reach towards the back of the cave, and the ground is speckled with large and small rock formations that provide natural furniture for the small space.  A thin band of water glistens upon one of the wall faces and sparkles faintly in the ambient light.}}&lt;br /&gt;
&lt;br /&gt;
;Ocean Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Ocean Sanctuary&lt;br /&gt;
|desc=Tranquil and serene, the surface of the ocean below you is as smooth as glass and equally reflective. Golden motes of light glisten as they pass through the smooth water to disappear in the shadowy depths, while random clouds drift past the translucent walls of the sanctuary to create darker images below.  The air is still with a feeling of waiting, as if the world holds its breath, and sound is muffled.}}&lt;br /&gt;
&lt;br /&gt;
;Oxbow Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Oxbow Sanctuary&lt;br /&gt;
|desc=Cradled by verdant hills, the bend of the river rises high against the hillside, while dropping away to white silt in the valley.  Violets, bluebells, and chamomile flowers dot the landscape, where rich grasses rise and fall with the wind.  The rushing water is deep blue and rainbow salmon arch their bodies against the current to reach the river&#039;s zenith.}}&lt;br /&gt;
&lt;br /&gt;
;River Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=River Sanctuary&lt;br /&gt;
|desc=Tumbled stones and pebbles cover the muddy expanse of the riverbed, their surfaces covered in brown and green algae.  Transparent walls swirl with the flow of water that parts around the sanctuary.  Some of the clear liquid bubbles up and over the strange, translucent dome ceiling.  A spray of color tickles the moist air as a cool breeze passes by.}}&lt;br /&gt;
&lt;br /&gt;
;Snow Runestone&lt;br /&gt;
You are bathed in a snow white light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Snow Sanctuary&lt;br /&gt;
|desc=Thick and blinding, the blizzard howls beyond the translucent icy walls of the sanctuary.  Within the shelter, a lazy swirl of snow dances in the ambient illumination and falls to the soft, smooth ground.  A series of icy mounds provide resting places, while a warm fire burns fitfully at the center of the room.  Oddly, the ice does not melt from the heat of the blaze.}}&lt;br /&gt;
&lt;br /&gt;
;Solar Runestone&lt;br /&gt;
You are bathed in an intense yellow light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Solar Sanctuary&lt;br /&gt;
|desc=Wrapped in a bubble of energy that protects against the heat, the sanctuary is cocooned within an inferno of orange and yellow light.  Cracks in the surface give way to pulses of energy that seek ways through the protective shell, though they disperse before they can break through.  A red nimbus covers the floor, which vibrates slightly.}}&lt;br /&gt;
&lt;br /&gt;
;Spring Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Spring Sanctuary&lt;br /&gt;
|desc=Ringed on all sides by fiddlehead and silver-leaf ferns, the spring is fed by a small stream that can be glimpsed through the sprawling vegetation.  Tulips, water lilies, and honeysuckle vines dot the banks, while a fallen log stretches across the spring and houses the echoing chirp of a cricket.  A trio of water sliders dances across the surface, creating ripples that radiate outward.}}&lt;br /&gt;
&lt;br /&gt;
;Stream Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Stream Sanctuary&lt;br /&gt;
|desc=The petite and narrow stream winds its way through a wall of vegetation along the edges of the sanctuary and then disappears.  Tiny pebbles within the water glisten and provide a soothing, burbling backdrop to the subtle sounds of the surrounding vegetation.  Strands of tall reeds add their own chime, while dark lotuses gaze at their reflections in the crystal clear water.}}&lt;br /&gt;
&lt;br /&gt;
;Sun Runestone&lt;br /&gt;
You are bathed in an intense yellow light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sun Sanctuary&lt;br /&gt;
|desc=Pulsating bright and round above, an enormous orb fills the sky and radiates long tendrils of orange, red, and yellow flames.  Swirling mist, balmy and tingling to the touch, obscures the ground, while a deep hum thrums through the sanctuary.  The air is dry, though filled with a deep warmth that is almost uncomfortable.}}&lt;br /&gt;
&lt;br /&gt;
;Sunburst Runestone&lt;br /&gt;
You are bathed in an intense yellow light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sunburst Sanctuary&lt;br /&gt;
|desc=Bright, though not uncomfortably so, the sanctuary&#039;s walls are bathed in orange, red, and yellow light.  Swirls of energy lick upward from the floor to coil on anything in their path, their tendrils warm and comforting.  Random solar flares pulsate through the sky in flashes of bright white light, and a constant wind, dry and warm, stirs the air.}}&lt;br /&gt;
&lt;br /&gt;
;Swamp Runestone&lt;br /&gt;
You are bathed in a sickly green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Swamp Sanctuary&lt;br /&gt;
|desc=Large and gnarled, the roots of the mangrove form parabolic arches as they rise from the fetid swamp in a ring around the small island sanctuary.  Clinging lichens, pale yellow and red, snake their way up the thick trunks, while the limbs are heavy with near black vines and mosses.  A screech owl makes its presence known at regular intervals, its strange cry echoing off the murky, dark waters and is accompanied by the constant hum of mosquitos.}}&lt;br /&gt;
&lt;br /&gt;
;Taiga Runestone&lt;br /&gt;
You are bathed in a forest green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Taiga Sanctuary&lt;br /&gt;
|desc=Tall conifers reach towards the sky with their spindly trunks and shed pine needles every time the wind shifts through them.  A ring of fallen trees hugs the granite facing, which comes to life with a burbling stream of clear spring water.  Soft rays of the sun fall in long dim slants upon the frost-covered ground.}}&lt;br /&gt;
&lt;br /&gt;
;Tidal Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Tidal Sanctuary&lt;br /&gt;
|desc=Water-smoothed boulders and stones surround the edges of the sanctuary in an earthy barrier on three sides, while the rush of the open ocean stretches beyond.  Moist sand is speckled with tiny tidal pools that house urchins, crabs, and starfish, while spotted periwinkle snails cling to the boulders that are submerged in water.  Several long skeins of seaweed lap at the shore as the tide pushes them along.}}&lt;br /&gt;
&lt;br /&gt;
;Tree Runestone&lt;br /&gt;
You are bathed in a forest green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Tree Sanctuary&lt;br /&gt;
|desc=Glittering light filters through the arching boughs of the sanctuary, its source distant and obscured by the glossy leaves of the tree.  Hundreds of laden limbs rise from the monstrous trunk only to curve over to create a living umbrella of greenery that shelters its denizens from the world beyond.  The soft chatter of chipmunks and squirrels rises and falls through the area, its source somewhere deep within the tree.}}&lt;br /&gt;
&lt;br /&gt;
;Tropical Runestone&lt;br /&gt;
You are bathed in an aqua blue light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Tropical Sanctuary&lt;br /&gt;
|desc=Balmy air moves across the desolate beach, its tendrils scented with ripe fruits and exotic flowers.  Upon one side of the sanctuary, the ocean laps at the sandy coastline in a quiet rhythmic motion, while the palm fronds of enormous trees on the opposite end sway in counterpoint to the tide.  A cluster of lazy clouds drifts above over a sky that is brilliant blue and is speckled with the vibrant hues of strange, long-feathered birds that squawk lyrically as they pass.}}&lt;br /&gt;
&lt;br /&gt;
;Volcano Runestone&lt;br /&gt;
You are bathed in a deep red light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Volcano Sanctuary&lt;br /&gt;
|desc=Encased in a bubble of orange swirled with obsidian, the sanctuary is illuminated from above by a swiftly flowing river of fiery crimson magma.  Rocky formations melted and twisted from the extreme temperatures throughout smoke slightly and radiate a burning heat that is almost stifling.  A deep rumble vibrates through the glassy floor and dislodges soot and ash from their resting places high above.}}&lt;br /&gt;
&lt;br /&gt;
;Wasteland Runestone&lt;br /&gt;
You are bathed in a sandy tan light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Wasteland Sanctuary&lt;br /&gt;
|desc=Pock-marked with stagnant craters, the largely barren landscape is covered in a clinging silver mist that stretches as far as the eye can see.  Putrid and noxious scents rise from tepid pools, whose edges are overrun with black mold and mushrooms.  The air is oppressive and tainted with foul scents.}}&lt;br /&gt;
&lt;br /&gt;
;Will-O-Wisp Runestone&lt;br /&gt;
You are bathed in a flickering yellow light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Will-O-Wisp Sanctuary&lt;br /&gt;
|desc=Amorphous motes of light speckle the silver and grey mist that drifts from the cool ground, their source indiscernible.  Faint swirls move the cool air around, and a quiet song, its words ancient and forgotten before they can be remembered, plays a haunting tune that fills the sanctuary.  The mist clings to the ground and shifts with the slightest movement through the area.}}&lt;br /&gt;
&lt;br /&gt;
;Wood Runestone&lt;br /&gt;
You are bathed in a forest green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Wood Sanctuary&lt;br /&gt;
|desc=Silver-leafed aspens rise on all sides, their limbs lifting to the sky and reaching out towards each other. Tufts of grass cling to a small game trail that winds its way between the slender giants, the edges dotted with dark stones and blue slate. A brown wren warbles quietly as it gazes down from above, its body nearly hidden against the pale bark.}}&lt;br /&gt;
&lt;br /&gt;
;Woodland Runestone&lt;br /&gt;
You are bathed in a forest green light and your surroundings shift...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Woodland Sanctuary&lt;br /&gt;
|desc=Spindly arms reach toward the distant sky, their frames ringed in thin white bark that is banded with ebon lines.  Elliptical leaves shimmer brilliant crimson and amber like the dying light of a summer day and are moved by the low breeze that swirls through the area.  The rich aroma of loam, moss, and grass scents the air, and a sense of peace pervades the sanctuary.}}&lt;br /&gt;
&lt;br /&gt;
;Neutral Sanctuary&lt;br /&gt;
A swirling grey mist enshrouds you as your surroundings blur for a moment...&lt;br /&gt;
{{RoomDescription&lt;br /&gt;
|roomname=Sanctuary &lt;br /&gt;
|desc=A grey, swirling mist surrounds you, its tendrils creeping around your feet and twisting into a thick, translucent mass that vaguely forms a curved wall around the chamber. A feeling of calmness and protection passes over you as you sense that nothing harmful may pass the swirling walls.}}&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Smite/Bane (302)]] ==&lt;br /&gt;
&lt;br /&gt;
;Smite&lt;br /&gt;
:A scintillating, blue-white aura encompasses TARGET.&lt;br /&gt;
&lt;br /&gt;
;Bane&lt;br /&gt;
:A sickly, violet haze encompasses TARGET.&lt;br /&gt;
&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Well of Life (308)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, your skin tingles with electrical energy. &amp;lt;section end=Charl 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, you smell the aroma of fine wine. &amp;lt;section end=Cholen 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, your face tingles briefly with heat like that of a nearby forge. &amp;lt;section end=Eonak 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, you hear the faint rustling of autumn leaves. &amp;lt;section end=Imaera 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a pattern of stars flickers faintly before you before fading away again. &amp;lt;section end=Jastev 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a shaft of light like a well-thrown spear flashes briefly across your sight. &amp;lt;section end=Kai 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, for only an instant, you glimpse the flows of mana coursing around you. &amp;lt;section end=Koar 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the chill of winter spreads slowly through your body. &amp;lt;section end=Lorminstra 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a few wisps of grey mist drift past you. &amp;lt;section end=Lumnis 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the light smell of spring flowers in bloom washes over you. &amp;lt;section end=Oleani 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, warmth caresses your skin like the touch of the noontide sun. &amp;lt;section end=Phoen 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a tide of dreamlike lassitude washes through you. &amp;lt;section end=Ronan 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, you hear the light sound of two coins clinking together. &amp;lt;section end=Tonis 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a deep, rich purring, more felt than heard, vibrates through your body. &amp;lt;section end=Andelas 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the area seems to darken for a moment. &amp;lt;section end=Eorgina 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the smell of dry, ancient parchment drifts past. &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the smell of tuberose incense twines slowly around you. &amp;lt;section end=Ivas 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a scaly texture rasps slowly over your skin. &amp;lt;section end=Luukos 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, an acrid, alien smell creeps slowly through the air. &amp;lt;section end=Marlu 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a phantom pressure briefly encircles each of your wrists. &amp;lt;section end=Mularos 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the cackle of a jackal echoes in your skull. &amp;lt;section end=Sheru 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the coppery scent of drying blood saturates your senses. &amp;lt;section end=V&amp;amp;#39;tull 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a sensation like feathers brushes over your face. &amp;lt;section end=Gosaena 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a wild, silvery giggle rings in your head. &amp;lt;section end=Zelia 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the delicate scent of jungle lilies wafts around you. &amp;lt;section end=Aeia 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, you feel the hilt of a knife pressing against your palm. &amp;lt;section end=Amasalen 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, and a sticky feeling, like spiderweb encasing your skin, wraps briefly around you. &amp;lt;section end=Arachne 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 308 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ghezresh 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, you hear the distinct, controlled swish of a long blade cutting through the air. &amp;lt;section end=The Huntress 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, a light breeze caresses your skin. &amp;lt;section end=Jaston 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the taste of acantha leaf tea fills your mouth. &amp;lt;section end=Kuon 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the dusky, dense smell of drying roses drifts past. &amp;lt;section end=Laethe 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the smell of trillium flowers surrounds you briefly. &amp;lt;section end=Leya 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the brief sensation of a dagger against your throat flashes past. &amp;lt;section end=Onar 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the smell of the sea washes gently past. &amp;lt;section end=Niima 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, you hear a few bars of merry, skillfully whistled melody. &amp;lt;section end=Tilamaire 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, the fresh smell of dew-laden roses in bloom drifts past. &amp;lt;section end=Voaris 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 308 /&amp;gt;&lt;br /&gt;
:As you sense your souls have linked together, you hear the distant clash of sword upon shield. &amp;lt;section end=Voln 308 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 308 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Other 308 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Condemn (309)]] ==&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; An ear-splitting crack of thunder staggers TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A distant roll of thunder gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Lightning spears down from overhead and sears TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The growl of thunder high above TARGET fades away.&amp;lt;section end=Charl 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Raucous, mocking laughter fills the air, and TARGET cringes beneath its onslaught!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A faint ripple of mocking laughter surrounds TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Barbs of ridicule and scorn take physical form, piercing TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The sound of laughter directed at TARGET grows distant and fades away.&amp;lt;section end=Cholen 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; TARGET startles at the sudden, clamorous ring of metal on metal!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A faint metallic susurration gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; *Clang!*  The air reverberates with metallic echoes, blasting TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The rhythmic ring of striking metal surrounding TARGET fades away.&amp;lt;section end=Eonak 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A guttural chorus of snarling wolves fills the air, freezing TARGET in (his/her/its) tracks!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A distant, lonely howl gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A grey-furred lupine shape leaps at TARGET, viciously biting (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The harsh growls surrounding TARGET fade away. &amp;lt;section end=Imaera 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A dizzying array of indistinct forms, each akin to TARGET, shimmers into view!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A hazy echo of TARGET flickers into view for just a moment, but nothing comes of it. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A blurry echo of TARGET rushes at (him/her/it), inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; One by one, the multitudinous echoes of what might have been surrounding TARGET fade away.&lt;br /&gt;
 &amp;lt;section end=Jastev 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; An array of silvery weapons takes shape nearby, each angled menacingly toward TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; Silver light flickers around TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; With a powerful swing, a silver (war hammer|mace|morning star|crowbill|ball and chain) catches TARGET a sound blow, inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The silvery armaments surrounding TARGET flicker and fade away. &amp;lt;section end=Kai 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A single deep, resonant tone reverberates through the area, commanding TARGET&#039;s attention!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A brassy gleam flickers around TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; TARGET is bathed in the brazen light of judgement and suffers X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The last lingering shiver of metallic sound surrounding TARGET fades away. &amp;lt;section end=Koar 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; The ambient temperature abruptly plummets, sending TARGET into fits of shivering.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A chill breeze briefly swirls around TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Ripples of cold white flame flare up around TARGET and blister (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The icy chill surrounding TARGET fades away. &amp;lt;section end=Lorminstra 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Crisp lines of brilliant color circle TARGET, forming five rings in constant motion about (him/her/it).&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; Faint rings of color flicker around TARGET for a moment, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; (Black/blue/green/red/white) energy flares around TARGET and sears (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The colored rings surrounding TARGET slow their motion and fade away.&amp;lt;section end=Lumnis 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Drifting cherry blossom petals shimmer into view all around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; The delicate, fleeting scent of spring flowers wafts from TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A petal falls upon TARGET and ignites, blooming into crimson fire and scorching (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The pale petals drift to the ground around TARGET and fade away.&amp;lt;section end=Oleani 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen  &amp;lt;section begin=Phoen 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; The radiance of the sun surges from you to envelop TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; The air briefly warms between yourself and TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Light flares, hot and fierce, searing TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The air cools around TARGET as the blinding brilliance fades away.&amp;lt;section end=Phoen 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Shadows deepen all around, enveloping TARGET in night&#039;s embrace!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; Shadows encroach on TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Dancing with dreamlike languor, tongues of black and silver flames sear TARGET for X points of damage! &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The deep shadows surrounding TARGET fade away. &amp;lt;section end=Ronan 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Fiery golden sparks flicker in a blurred arc around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A fiery golden mote blurs past TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Blurry golden motes arc past TARGET, inflicting X points of damage in their wake!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The golden sparks circling TARGET fade away. &amp;lt;section end=Tonis 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A low, rumbling growl fills the air, freezing TARGET in (his/her/its) tracks!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; An angry feline yowl gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A sleek black shape leaps past TARGET and lashes out with sharp claws, slashing (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The rumbling growl directed at TARGET fades away. &amp;lt;section end=Andelas 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Darkness encroaches, commanding attention, and TARGET quails before it!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; The air around TARGET darkens briefly, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Flames erupt around TARGET, scorching (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The looming darkness around TARGET fades away.&amp;lt;section end=Eorgina 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Blazing lines of pure arcane energy scribe themselves on the air around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A faint tangle of thready gold briefly flickers into being around TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Precise arcs of golden energy slash TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The brilliant arcane lines surrounding TARGET unravel and fade away. &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Shimmering smoke, fragrant with musk, gathers around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A tendril of perfumed smoke drifts past TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Sinuous smoke winds about TARGET in intimate coils, inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The air clears as the aromatic smoke clinging to TARGET fades away. &amp;lt;section end=Ivas 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; The pungent stench of decay fills the air as mist rises from the (floor/ground) around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A nearby rasping hiss gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Skeletal appendages burst from the (floor/ground) and tear into TARGET, inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The scent of the grave around TARGET fades away. &amp;lt;section end=Luukos 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A shifting rent in reality forms near TARGET, and from it blows a caustic, alien wind.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; The air warps and twists around TARGET for a moment, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Barbed, glistening tentacles dart from the tear in space and rip into TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The caustic wind dies as the shifting rent near TARGET fades away. &amp;lt;section end=Marlu 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; TARGET releases a sudden cry of agony!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A distant shriek of pain gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; TARGET staggers beneath the weight of inconsolable sorrow, tearing at (him/her/it)self and inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The lingering cries of TARGET fade away. &amp;lt;section end=Mularos 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Darkness encroaches on TARGET, and numerous eyes gleam malevolently within it!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; TARGET pauses, clearly uneasy, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A gibbering wave of shadowy beasts surges from the dark and over TARGET, inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The darkness surrounding TARGET withdraws and fades away. &amp;lt;section end=Sheru 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; The cacophony of pitched battle fills the air, disorienting TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A distant clash of battle gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; TARGET is overcome by a sudden frenzy of bloodlust and, in (his/her/its) confusion, slashes (him/her/it)self for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The battlefield tumult surrounding TARGET fades away.&amp;lt;section end=V&amp;amp;#39;tull 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Silence falls, muffling TARGET in its velvet folds.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; For a moment, all grows quiet around TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; The chill of eternity presses in, freezing TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The hush passes and the chill surrounding TARGET fades away. &amp;lt;section end=Gosaena 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Ineffable color blooms around TARGET, accompanied by a dissonant ripple of bells.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A sudden, wavering giggle gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Fleeting shapes beyond reason or description surge into being and batter TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The strange colors and discordant notes besetting TARGET fade away. &amp;lt;section end=Zelia 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia  &amp;lt;section begin=Aeia 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A host of exotic flowers bursts into brilliant bloom around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; The heady aroma of blooming flowers wafts from TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A glistening blossom releases a burst of caustic mist at TARGET, inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The exotic flowers around TARGET curl in on themselves and fade away. &amp;lt;section end=Aeia 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Scarlet mist seeps from TARGET, accompanied by the cloying, coppery scent of fresh blood.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A whiff of blood comes off TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Crystallized crimson shards coalesce from the scarlet mist, slashing TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The scarlet mist surrounding TARGET settles and fades away. &amp;lt;section end=Amasalen 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; TARGET is surrounded by an ominous, chitinous clicking!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A nearby skittering noise gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Countless spiders swarm TARGET, skittering up (his/her/its) flailing form and inflicting X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The clicking sounds surrounding TARGET fade away. &amp;lt;section end=Arachne 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; An undulating silver mist rolls in, enveloping TARGET within its coils!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A faint thread of silver mist drifts about TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Tendrils of silver mist plunge into TARGET, eroding (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The undulating silver mist surrounding TARGET fades away. &amp;lt;section end=Ghezresh 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; The air around TARGET vibrates with the low, strident blast of a hunting horn!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A distant horn blast gives TARGET pause, but nothing comes of it. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Misty figures with vengeful, star-bright eyes course past TARGET, slashing (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The ethereal hunters veer off from TARGET and fade away.&amp;lt;section end=The Huntress 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Discordant birdcalls fill the air as the wind picks up around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; An errant breeze brushes by TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A fierce gust of wind from the (east/north/south/west) blasts TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The wind dies down around TARGET and the birdcalls fade away.&amp;lt;section end=Jaston 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A sprawling carpet of translucent herbs blooms around TARGET, seemingly innocuous in nature.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A medicinal scent wafts from TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Lush overgrowth constricts around TARGET, crushing (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The translucent foliage surrounding TARGET fades away. &amp;lt;section end=Kuon 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A hot, ash-laden wind begins to blow around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; Ash drifts past TARGET on a warm breeze, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; An ash-laden whirlwind of smoldering black rose petals coils around TARGET, scorching (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The wind around TARGET dies and its warmth fades away. &amp;lt;section end=Laethe 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A series of high, ululating war cries spooks TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A snowy owl glides past TARGET on silent wings, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Borne on silent wings, a snowy owl dives from the sky at TARGET and inflicts X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; A final trill rings out near TARGET, then fades away. &amp;lt;section end=Leya 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A heavy, salt-scented fog rolls in and drifts around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A tendril of salt-laden fog drifts past TARGET, but nothing comes of it. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; The rippling silhouette of a cresting wave coalesces from the fog and crashes upon TARGET, hammering (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The dense fog around TARGET thins and fades away. &amp;lt;section end=Niima 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; The shadows around TARGET grow deeper, and the air thrums with tension.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; An indistinct shadow passes behind TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A thin black dagger, more shadow than substance, fades into view mid-flight and strikes TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The tension in the air surrounding TARGET fades away. &amp;lt;section end=Onar 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A rich tapestry of music weaves itself out of the air, and TARGET pauses to listen.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A distant melody gives TARGET pause, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; The music reaches a crescendo, and the sheer force of it staggers TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; After a gentle concluding passage, the music surrounding TARGET fades away. &amp;lt;section end=Tilamaire 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; A hot, blustery wind begins to blow around TARGET!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; A warm gust of wind curls past TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A fiery whirlwind of luminous yellow rose petals coils around TARGET, scorching (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The wind around TARGET dies and its warmth quickly fades away.&amp;lt;section end=Voaris 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; TARGET flinches back from a sudden upwelling of white light!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; White light flickers around TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; Cleansing white fire envelops TARGET, searing (him/her/it) for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The white light surrounding TARGET fades away. &amp;lt;section end=Voln 309 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 309 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Success]}}&#039;&#039;&#039; Dusky half-light envelops a TARGET in a rippling, nebulous haze.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Failure]}}&#039;&#039;&#039; The air ripples dimly around a TARGET, but nothing comes of it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Damage]}}&#039;&#039;&#039; A sudden flare of coruscating energy within the haze sears the TARGET for X points of damage!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Debuff end]}}&#039;&#039;&#039; The nebulous haze fades away from a TARGET.&amp;lt;section end=Other 309 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Blind (311)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the fury and violence of the Lord of the Seas flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Charl 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the merriment and goodwill of the Jester flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Caster&#039;s face shimmers and vanishes, and, in its place, you see the image of a young, golden-haired man with a smile of delight curving his lips. His eyes are the color of the sky, and they sparkle brightly with merriment. Divine radiance blazes around the image, and you are blinded. &amp;lt;section end=Cholen 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the strong will and determination of the Master of the Forge flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the craggy face of a dwarven man. An aura of reddish-golden light, much like the glow of a forge, surrounds his features. His brown gaze bores into you, and the image sears itself into your eyes before everything goes black. &amp;lt;section end=Eonak 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the warmth and healing power of the Lady of the Green flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a beautiful sylvan woman garbed in robes of leaves and flowers. A halo of pale green radiance surrounds her, and healing light shines in her eyes as she smiles jubilantly -- but then the light fades, and everything else fades along with it. &amp;lt;section end=Imaera 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the tenuous, fleeting beauty of the world as the vision of the Soothsayer flows through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a pale, black-haired young man. Behind him, the night sky shines, thousands of stars shimmering in incredible beauty, but his face is filled with devastating sorrow even as he gazes into the night. Suddenly, the stars blaze with searing silver brilliance, and you are blinded. &amp;lt;section end=Jastev 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &amp;lt;section end=Kai 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the majesty of the King of the Gods flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of an ancient man wearing a majestic crown of pure light. The lines of his face are weary, and a great, snow-white beard flows from his chin, but his heavy-lidded blue eyes transfix you with their power. Divine radiance blazes around the image, and you are blinded. &amp;lt;section end=Koar 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the somber, majestic power and the caring presence of the Gatekeeper flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a thin woman with alabaster-hued skin. Snowflakes collect in her raven black hair, and winter&#039;s chill sweeps over you as her somber gaze meets yours. The image sears into your vision, and then everything goes dark. &amp;lt;section end=Lorminstra 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the wisdom and knowledge of the Queen of Enlightenment flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a mature woman robed in cloud grey gossamer. A single streak of grey hair mars her black tresses, and her face is serenely calm. Divine radiance blazes around the image, and you are blinded. &amp;lt;section end=Lumnis 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; &amp;lt;section begin=311Oleani1p /&amp;gt;As your faith overcomes &amp;lt;target&amp;gt;&#039;s weakened defenses, you sense the radiance and love of the Mistress of Adoration flowing through you.&amp;lt;section end=311Oleani1p /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &amp;lt;section begin=311Oleani2p /&amp;gt;&amp;lt;caster&amp;gt;&#039;s face shimmers and vanishes, and, in its place, you see the image of an exquisitely beautiful Dark Elf with spring flowers braided into her hair.  A warm smile curves her lips as she gazes at you from beneath lowered lashes.&amp;lt;section end=311Oleani2p /&amp;gt; &amp;lt;section end=Oleani 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, your skin grows warm with the touch of sunlight as the masculine power of the Sun God flows through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a gaunt man with golden hair that shines as brightly as the sun. His smile is confident and proud, and a touch of arrogance blazes in his blue eyes. Divine radiance flares around the image, and you are blinded. &amp;lt;section end=Phoen 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the dark, watchful power of the Lord of Dreams flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Ronan 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &amp;lt;section end=Tonis 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &amp;lt;section end=Andelas 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the domineering majesty of the Queen of Darkness flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see an imperious and beautiful woman wearing a magnificent crown of sparkling black diamonds.  An expression of cruel satisfaction rests upon her shadowed visage.  Darkness wells forth to consume the image, and then you see nothing at all. &amp;lt;section end=Eorgina 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the knowledge and intellectual interest of the Grandfather flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the passion and sensuality of the Seductress flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a staggeringly beautiful woman. Shimmering smoke surrounds her face, distorting it slightly, but her long-lashed eyes gaze knowingly into yours, dark with an unmistakable invitation. The image sears itself into your eyes before everything dissolves in a wash of grey. &amp;lt;section end=Ivas 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the cruel malice of the Eater of Souls flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a massive emerald green serpent. The snake&#039;s golden eyes transfix you with their power as its forked tongue darts out to taste the air. Darkness wells forth to consume the image, and then you see nothing at all. &amp;lt;section end=Luukos 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the Destroyer&#039;s unthinking hunger for annihilation flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a gruesome demon. The monster&#039;s skin is glistening black, hooked wings arch above his inhuman features, and barbed tentacles lash and writhe restlessly around its body from appendages that bear only the faintest resemblance to arms. Darkness wells forth to consume the image, and then you see nothing at all. &amp;lt;section end=Marlu 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the compassion, pain, and longing of He who is the Sorrow of the World flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a young man with incredibly compassionate eyes. His features are as delicate as an elven child&#039;s, but a bloody lash-stroke mars his skin near the collar of his white robe. The image sears itself into your vision before everything dissolves in a wash of scarlet. &amp;lt;section end=Mularos 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the cruel, feral power of the Bringer of Terror flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see a pair of feral amber eyes gleaming out of darkness. Faintly, you can discern the outline of a jackal&#039;s head, but the proportions are subtly distorted -- the muzzle is too large to properly fit the head, and needlelike teeth gleam menacingly behind black lips. Darkness wells forth to consume the image, and then you see nothing at all. &amp;lt;section end=Sheru 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the ecstatic bloodlust of the Berserker flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a giantman with marble white skin. His coal black eyes stare vengefully down at you, an expression of threat made only more dire by the bloodstained armor concealing his vast bulk. The image sears itself into your vision before everything dissolves in a wash of scarlet. &amp;lt;section end=V&amp;amp;#39;tull 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, your skin grows cold as the calm, silent power of the Mistress of Eternity flows through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see a somber woman swathed in a grey cloak. Her face is as pale as alabaster, and her features are composed with perfect, unwavering serenity. The air grows cold as her ice blue gaze rests upon you. The intensity of the vision overwhelms you, and everything dissolves in a wash of grey, leaving you blinded. &amp;lt;section end=Gosaena 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the madness of the Keeper of the Moons rising in you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see four crescent moons wheeling wildly through a sky that flashes with a thousand different colors. A pair of large emerald eyes stare down on you from above the moons, set in a constantly shifting face framed by long, windblown silver hair. The delighted laughter of a madwoman fills your ears as you grow more and more disoriented, and then the intensity of the vision overwhelms you. Everything dissolves in a wash of grey, leaving you blinded. &amp;lt;section end=Zelia 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the warmth and nuturing comfort of the Mother flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a beautiful human woman with kind, quiet eyes. The leaves, flowers, and vines of a verdant tropical garden twine through her hair and caress her shoulders, with one particularly large lily spreading its milk-white petals across her brow. A faint glow halos her features for only a moment before her face, and everything else, vanishes from view. &amp;lt;section end=Aeia 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the frenzied religious ecstasy of the Executioner flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a cruelly smiling Faendryl man with dark bronze skin and slitted golden eyes. Flowing white hair courses over his lean neck and shoulders. Like blood spilling up from a cut, darkness wells forth to consume the image, and then you see nothing at all. &amp;lt;section end=Amasalen 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a brash woman with a fighter&#039;s build, clad in bloodstained leather armor. One of her eyebrows is slightly raised, and her smirk is distinctly condescending. Superimposed over her face, the image of a black widow spider shimmers into view, then fades away again. As the spider vanishes, everything else falls into darkness, leaving you blind. &amp;lt;section end=Arachne 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the powerful and oppressive intimidation of Ghezresh flow through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and in its place you see an omnipotent presence wreathed in indigo and silver mists.  From within the depths, an eel rises from CASTER&#039;s collarbone and wraps itself around CASTER&#039;s neck before clicking its jaws closed upon its tail.  Abruptly, the darkly intimidating mists recede. &amp;lt;section end=Ghezresh 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the cold, exquisitely controlled anger of the Huntress flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a surpassingly beautiful woman whose face is a mask of carefully controlled anger. A silvery scythe blade curves alongside her face, and the reflection across the mirror-polished surface displays the eight-pointed star Krr&#039;ska. Light flashes from the scythe blade into your eyes, and then everything goes black. &amp;lt;section end=The Huntress 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the blithe, soaring spirit of the Windrunner coursing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a slender sylvan man with six white-feathered wings growing from his back.  A wide band of many-colored feathers adorns his head, offering some minor restraint for his windswept, light brown hair as well as lending a rakish quality to his carefree smile.  Silvery radiance flashes around his face in the instant before everything goes dark. &amp;lt;section end=Jaston 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &amp;lt;section end=Kuon 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the sorrowful compassion of the Lovelorn flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;S face shimmers and vanishes, and, in its place, you see the image of a young man with delicately fair skin, raven black hair, and sorrowful blue eyes.  Despite the lines of emotional pain that mark his features, his gaze is filled with vast compassion.  After only a few seconds pass, the young man&#039;s face fades away into blackness, and everything else vanishes into blackness as well. &amp;lt;section end=Laethe 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the cool confidence of the Master of Martial Arts flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a woman in her twenties with wavy mahogany hair and azure eyes. Calm, unquestioning confidence fills her expression as she gazes directly at you, mitigated only slightly by the concealed shadow of sorrow. The image sears itself into your eyes before everything dissolves in a wash of grey. &amp;lt;section end=Leya 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the merry, flirtatious delight of the Wavedancer flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see a waiflike young woman with shining blue eyes and a dazzling smile. Her pale blonde hair flows over her milk-white shoulders as smoothly as water, and you briefly smell a fresh sea breeze in the moment before everything goes dark. &amp;lt;section end=Niima 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a cracked white skull. Shadows play over the pale bone surface, but never fully resolve into recognizable forms. Abruptly, the skull vanishes into complete and utter blackness -- along with everything else around you. &amp;lt;section end=Onar 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you hear the echoes of a laughter-filled melody, and you sense the exuberant spirit of the Lithe flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of an exuberant young man with tawny hair.  His wide eyes sparkle with amusement, and a playful smile teases at his full lips.  Golden radiance flashes around his face in the instant before everything goes dark. &amp;lt;section end=Tilamaire 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the merry pleasure of the Patron of Young Love flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a young man with delicately fair skin, sunlight golden hair, and merry blue eyes framed by long blond lashes. He presses a blood red rose to his cheek as he flashes a mischevious, flirtatious smile. Golden radiance flashes around his face in the instant before everything goes dark. &amp;lt;section end=Voaris 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 311 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As your faith overcomes TARGET&#039;s weakened defenses, you sense the grim, determined spirit of the Paladin flowing through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s face shimmers and vanishes, and, in its place, you see the image of a grim man clad in a full suit of black chainmail. His cold, somber eyes stare straight past you, and the faint halo of white radiance surrounding him only seems to deepen the shadows of his forbidding visage. The image sears itself into your eyes before everything dissolves into blackness. &amp;lt;section end=Voln 311 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Other&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Prayer (313)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the wrath of your deity to protect you. The scent of brine and lightning-struck sand surrounds you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Brilliant white light flickers in CASTER&#039;s eyes. &amp;lt;section end=Charl 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the humor of your deity to protect you. You taste fine wine on your lips, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Sapphire light dances in CASTER&#039;s eyes. &amp;lt;section end=Cholen 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the labor of your deity to protect you. Your eyes sting as if with the touch of smoke or sweat, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Dark red light glimmers in CASTER&#039;s eyes. &amp;lt;section end=Eonak 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the bounty of your deity to protect you. The smell of ripe wild raspberries swirls around you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Leaf-green light shines in CASTER&#039;s eyes. &amp;lt;section end=Imaera 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the foresight of your deity to protect you. All hues around you gain brilliance as all shadows around you deepen, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Brilliant white light burns in CASTER&#039;s eyes. &amp;lt;section end=Jastev 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the fist of your deity to protect you. Strength and confidence imbue your body, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Kai 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the justice of your deity to protect you. The ground trembles almost imperceptibly underfoot, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Intense golden topaz light blazes in CASTER&#039;s eyes. &amp;lt;section end=Koar 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the compassion of your deity to protect you. The delicate chill of autumn&#039;s first frost settles over your skin, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Pallid light glows in CASTER&#039;s eyes. &amp;lt;section end=Lorminstra 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the wisdom of your deity to protect you. Confidence and clarity settle over you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Opalescent light shines in CASTER&#039;s eyes. &amp;lt;section end=Lumnis 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the love of your deity to protect you. The smell of lily-of-the-valley surrounds you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Violet light sparkles in CASTER&#039;s eyes. &amp;lt;section end=Oleani 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the power of your deity to protect you. The warmth of sunlight caresses your skin, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Golden radiance burns in CASTER&#039;s eyes. &amp;lt;section end=Phoen 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the sword of your deity to protect you. The shadow of night darkens everything around you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Starry silver radiance shimmers in CASTER&#039;s eyes. &amp;lt;section end=Ronan 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the wings of your deity to protect you. A light ripple passes through the air, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Golden light shines in CASTER&#039;s eyes. &amp;lt;section end=Tonis 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the pleasure of your deity to protect you. A low, rumbling purr vibrates through your head, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Andelas 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the majesty of your deity to protect you. The scent of something burning drifts past, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Dark crimson light glitters in CASTER&#039;s eyes. &amp;lt;section end=Eorgina 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the knowledge of your deity to protect you. The smell of dusty parchment tickles your nose, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Pale yellow light flashes in CASTER&#039;s eyes. &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the desire of your deity to protect you. Your head swims as if with alcohol or incense, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Dusky silver light glitters in CASTER&#039;s eyes. &amp;lt;section end=Ivas 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the will of your deity to protect you. Something smooth yet hard rasps over your cheek, like the pebbled scales of a great serpent, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Emerald light glimmers in CASTER&#039;s eyes. &amp;lt;section end=Luukos 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the delight of your deity to protect you. Your skin stings as if with the touch of acid, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Lurid orange light gleams in CASTER&#039;s eyes. &amp;lt;section end=Marlu 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the love of your deity to protect you. The softness of silk caresses the back of your neck, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Ruby light glimmers in CASTER&#039;s eyes. &amp;lt;section end=Mularos 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the favor of your deity to protect you. Unbidden, your heartbeat quickens with fear, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Amber light glows in CASTER&#039;s eyes. &amp;lt;section end=Sheru 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=V&amp;amp;#39;tull 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the impartial hand of your deity to protect you. A delicate sensation like the caress of a feathered wing runs over your face from brow to chin, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Grey light fills CASTER&#039;s eyes briefly. &amp;lt;section end=Gosaena 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the fickle spirit of your deity to protect you. A sudden wind chills your exposed skin, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Brilliant emerald light shines in CASTER&#039;s eyes. &amp;lt;section end=Zelia 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the kindness of your deity to protect you. The smell of jungle rain drifts past you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Aeia 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the frenzy of your deity to protect you. The smell of fresh-spilled blood swirls around you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Blood red light shines in CASTER&#039;s eyes. &amp;lt;section end=Amasalen 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the webs of your deity to protect you. Painless heat surges through your bloodstream. The world blurs into eight distinct images before refocusing upon one, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Intense crimson light glows in CASTER&#039;s eyes. &amp;lt;section end=Arachne 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the oppressive intimidation of your deity to protect you. Your skin grows chill and clammy, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Silver-laced indigo mist seeps from CASTER&#039;s eyes.&amp;lt;section end=Ghezresh 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the anger of your deity to protect you. For an instant, all around you is silvered by starlight to your eyes, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=The Huntress 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the winds of your deity to protect you.  A light gust of air caresses your skin, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Sky blue light shines in CASTER&#039;s eyes.&amp;lt;section end=Jaston 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the caring of your deity to protect you. The aromas of pine needles and rich earth drift past you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Dark green light glows in CASTER&#039;s eyes. &amp;lt;section end=Kuon 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the sympathy of your deity to protect you. The soft, musky scent of roses twines about you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Dark violet light glimmers in &amp;lt;caster&amp;gt;&#039;s eyes. &amp;lt;section end=Laethe 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the skill of your deity to protect you. A sense of supple vitality flows through you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Azure light shimmers in CASTER&#039;s eyes. &amp;lt;section end=Leya 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the mercy of your deity to protect you. You taste sea salt on your lips, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Aquamarine light shimmers in CASTER&#039;s eyes. &amp;lt;section end=Niima 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the cool decisiveness of your deity to protect you. Nothing impressive happens externally, but your senses and awareness expand subtly, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Darkness flickers briefly in CASTER&#039;s eyes. &amp;lt;section end=Onar 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the teachings of your deity to protect you.  You hear a sprightly, joyous air being skillfully played on a flute, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Cerulean light sparkles in CASTER&#039;s eyes. &amp;lt;section end=Tilamaire 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the approval of your deity to protect you. The enticing scent of sun-warmed roses twines about you, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Brilliant yellow light shines in CASTER&#039;s eyes. &amp;lt;section end=Voaris 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Turning your thoughts inward, you ask for the shield of your deity to protect you. Something unseen settles around your torso like a suit of massive armor enclosing you. Instead of feeling weighted or weary, however, you feel uplifted, and you sense that your prayer has been granted.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Voln 313 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 313 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Other 313 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Censure (316)]] ==&lt;br /&gt;
===Pantheon of Liabo===&lt;br /&gt;
;Charl &lt;br /&gt;
:Speaking the words of a sacred incantation, you channel the power of divine displeasure toward those deserving of punishment. &lt;br /&gt;
:As the words capture your attention, you hear a second voice overlapping CASTER&#039;s and translating the invocation: &#039;&#039;&#039;&amp;quot;&amp;lt;section begin=Charl 316 /&amp;gt;&amp;lt;includeonly&amp;gt;:&amp;lt;/includeonly&amp;gt;For your transgressions, a thousand storms shall be raised against you, and lightning shall rain across your path and all you love!&amp;lt;section end=Charl 316 /&amp;gt;&amp;quot;&#039;&#039;&#039; Your spirit quails involuntarily at the power of the divine censure, and you feel your muscles tightening to disobey your will. (Non-bold part repeats on all.) &lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, you will be forever be marked as the punchline of the world&#039;s jokes, prone to the pranks of all, and endure the endless humiliation that will ensue.... &amp;lt;section end=Cholen 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, no tool will be true in your hand. Wood will buckle and splinter, metal will twist and shatter, and even the greatest of enchantments will fade without warning.... &amp;lt;section end=Eonak 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, all nature shall rise against you! The rivers shall rise to drown you, the trees shall yield poison fruit to your hand, and every animal will show you its fangs.... &amp;lt;section end=Imaera 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, I will tell you your future.  These are the words of the stars: all that you seek will be lost, and all that you fear will prosper until it destroys you.  In the end, you will be forgotten, and nothing you have done or been will ever matter. &amp;lt;section end=Jastev 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 316 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Kai 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, you shall be judged, and the verdict shall fall against you. In all the world, from sky to earth, there is no sanctuary against that high judgement.... &amp;lt;section end=Koar 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 316 /&amp;gt;&lt;br /&gt;
:The Gatekeeper&#039;s hand and key will be against you, parting your spirit and body, leaving you helpless in a mortal world that does not know your presence.... &amp;lt;section end=Lorminstra 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, you shall receive all that you have earned, for you are one who heeds no wisdom, and you are one who takes no guidance. Therefore, no wisdom and no guidance shall you have, and you shall be lost beyond redemption.... &amp;lt;section end=Lumnis 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, your loveless life shall bring you no satisfaction. Every relationship you have shall be sundered, until you walk alone through a joyless life without the strength to end it. &amp;lt;section end=Oleani 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, the sun shall give you no warmth in winter and relentless heat in summer. Its light will not feed your crops and its power will not give you strength.... &amp;lt;section end=Phoen 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, your dreams shall be hopeless, and your waking hours possessed by dreams. You shall have no peace waking or sleeping, for you will never fully enter, nor fully leave sleep, and there shall be no rest for you.... &amp;lt;section end=Ronan 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, your thoughts and actions will be slowed, and all eyes will be drawn to your stupid, clumsy sluggishness. You will be unable to protect your treasures from those in the shadows. &amp;lt;section end=Tonis 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, you will be hunted, little prey. Between shadow and light, between branch and wall, the eyes you cannot see will see you. The claws are sharp, and your flesh is weak. Run, little prey, for the chase is marvelous fun.... &amp;lt;section end=Andelas 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 316 /&amp;gt;&lt;br /&gt;
:For your carelessness, your spirit shall be shackled by invisible chains, rendering you a lowly slave. You will grovel at the feet of the one who controls your freedom, kissing the jeweled hem of her garments and begging for a chance to redeem yourself! &amp;lt;section end=Eorgina 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, text will blur before your eyes, and words will shift upon reaching your ear. You will never understand anything of value, and you will never be able to communicate that which you already know. &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, you shall know a hunger with no filling, a thirst with no quenching, and a yearning with no satisfaction. Every need you have will burn without ceasing until your entire body is aflame.... &amp;lt;section end=Ivas 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, the mark of the liar shall be upon you. No truth you speak shall ever be believed, setting every ally against you and all friendly blades at your back. In death, you shall be drawn into the service of those lies, and all you ever do will serve the hunger of the Serpent.... &amp;lt;section end=Luukos 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, your ever-fading power shall fuel the end of all that you know. Everything shall be destroyed, but you will face the oblivion first of all. &amp;lt;section end=Marlu 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, there will be no comfort for you. Your blood will run untended, and your heart will break unnoticed. You will break yourself to the ground, and break your wrists on a blade, all in the company of uncaring silence. &amp;lt;section end=Mularos 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 316 /&amp;gt;&lt;br /&gt;
:For your trangressions, the darkness shall surround you, and the amber-eyed spawn of your nightmares will join you there. Given flesh and given fangs, your nightmares shall come as you stumble helplessly through a night that knows no dawn.... &amp;lt;section end=Sheru 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, your blood will run across the soil like a river, and your splintered bones will be sown across the land! &amp;lt;section end=V&amp;amp;#39;tull 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, you will be judged in the land of death, where there is neither escape nor reprieve. The angels know when you will pass the gates, and their sickles are sharp enough to slice apart a soul.... &amp;lt;section end=Gosaena 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 316 /&amp;gt;&lt;br /&gt;
:No mist and no moonlight, no mercy, no insight! Your bones and your eyes, all your heart, all despised! Your luck is despair, and nobody will care when you scream in the rain, never escaping, so totally sane.... &amp;lt;section end=Zelia 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, there shall be no shelter for you anywhere that the Mother&#039;s eye sees. A garden to others will be withered dust to you. You will be homeless and helpless, rejected by all mothers, a wanderer forever without any kin or comfort. &amp;lt;section end=Aeia 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, your blood will flow from your body in rivers! Your skin will be stripped off to decorate the temple walls as your still-beating heart feeds the high altar.... &amp;lt;section end=Amasalen 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, disfiguring venom shall pour through your veins.  Strong men shall fear at your presence, weak ones shall faint away, and all will rise against you to exile you forevermore! &amp;lt;section end=Arachne 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 316 /&amp;gt;&lt;br /&gt;
:You shall now forever stand in the shadow of your allies.  Forevermore, you shall be inferior to their strength and a mere shadow of acceptance.  This will set you apart and consign you to forever be trapped in the mists of unlife at the bottom of the sea... &amp;lt;section end=Ghezresh 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, all those with cause against you shall have the strength of a hundred men apiece. Their hands will be guided divinely for true strikes and fatal blows, and the sands shall drink your life&#039;s blood without mercy. &amp;lt;section end=The Huntress 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, the gift of freedom shall be lost to you.  Imprisoned beneath stifling stone, you will long for the four winds to cleanse your skin, and dream of the silhouettes of birds against the sky.... &amp;lt;section end=Jaston 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, the plants of the world shall give you neither comfort nor shelter. Wooden walls will rot about you, and acantha will offer your wounded lips no healing grace.... &amp;lt;section end=Kuon 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 316 /&amp;gt;&lt;br /&gt;
:For your trangressions, all those you love will be parted from you, never to join you again.  There shall be neither comfort nor contact for you, not even in death&#039;s dark domain.... &amp;lt;section end=Laethe 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, the hands of all honorable people will turn against you, leaving you surrounded by traitors and fools. Fade your combatant skills will, offering you no reward for their application. &amp;lt;section end=Leya 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, the water you seek to drink will be as dust, and the water you seek to escape will overwhelm you. You will drown as the dolphins watch, and they will never move to aid you. &amp;lt;section end=Niima 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, a contract has been placed against you. The price for your life has already been paid. &amp;lt;section end=Onar 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, all music of this world will fall upon your accursed ear, offering no melody or harmony to soothe your being.&amp;lt;section end=Tilamaire 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, all those you love will be parted from you. Mountains and miles, chasms and seas, traditions and laws shall divide you! Ever shall your passion rise, and never shall your love be satisfied.... &amp;lt;section end=Voaris 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 316 /&amp;gt;&lt;br /&gt;
:For your transgressions, no punishment could be greater than that which you bring upon yourself. From death, undeath will enslave you. Your will shall be torn, your soul flayed to tatters, and not even enough of self-control shall remain for you to beg for a liberating sword.... &amp;lt;section end=Voln 316 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
&lt;br /&gt;
;Other &amp;lt;section begin=Other 316 /&amp;gt;&lt;br /&gt;
:Religious fervor infuses CASTER&#039;s voice as she speaks an incantation in an unknown language. &lt;br /&gt;
:For your transgressions, the greatest of wraths will enfold you. All punishment that you have earned will be portioned out to you, more than any spirit or body or soul can endure.... &amp;lt;section end=Other 316 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Raise Dead (318)]] ==&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Moisture beads upon your skin and you feel your eyes cloud over with the darkness of a rising storm.  Power builds upon the air, and when you utter the last syllable of your spell thunder rumbles from your lips.  The sound ripples upon the air, colliding with TARGET&#039;s prone form, and a brilliant flash transfers the spiritual energy between you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Moisture beads upon your skin as CASTER&#039;s eyes cloud over with the darkness of a rising storm. Power builds upon the air, causing the dead hair upon your arms to rise, and as CASTER utters the last words of her spell you hear the rumble of thunder in her voice. The rolling sound ripples upon the air and collides with your chest an instant before a brilliant flash suffuses you with raw spiritual energy.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Moisture beads on the skin of CASTER and TARGET as the former&#039;s eyes cloud over with the darkness of a rising storm. Power builds upon the air, causing the hair upon your arms to rise, and as CASTER utters the last words of his spell you hear the rumble of thunder in his voice. The rolling sound collides with TARGET&#039;s prone form, its very touch creating a brilliant flash that suffuses her in raw spiritual energy. &amp;lt;section end=Charl 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Musically, though lyric free, CASTER begins a soft chant in petition to her deity.  Rising from the air around her, the sweet sound of a lute begins to accompany her, and you discover that the very air seems alive with it.  Reaching outward, CASTER touches you on the lips, and the blended sounds burst into a wordless chorus that surges between the two of you in a shower of colorful lights.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Musically, though lyric free, CASTER begins a soft chant in petition to her deity. Rising from the air around her, the sweet sound of a lute begins to accompany her and you discover that the very air seems alive with it. Reaching outward, CASTER touches TARGET on the lips and the blended sounds burst into a wordless chorus that surges between the pair in a shower of colorful lights. &amp;lt;section end=Cholen 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;Chanting slowly, your mind and body fill with strong sense of purpose as you gaze down at TARGET.  Within your mind&#039;s eye you unravel the greater machinations of life and realize that the prone body lying before you is still needed to make them still work.  Touching one finger to his forehead, you reignite the spark of life within him and return him to their greater function.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Chanting slowly, the sound reminiscent of cogs moving through a large machine, CASTER gazes down at TARGET with a sense of greater understanding in his eyes. Briefly touching upon TARGET&#039;s forehead, CASTER reignites the spark of life within him. &amp;lt;section end=Eonak 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Breathing slowly, you extend your senses towards the world around you and draw into you the very essence of nature. You shift your gaze towards TARGET and carefully release the energy you&#039;ve drawn into yourself towards him. A rush of energy briefly flows between the two of you as you feel life slowly return to him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Breathing slowly on the heels of her chanting, CASTER&#039;s gaze grows distant for several moments.  With the grace of a doe lapping water at a brook, her gaze falls to you and your spirit feels strangely in tune with the natural order of life.  A rush of energy briefly flows between the two of you as you feel life slowly return to your limbs.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Breathing slowly on the heels of her chanting, CASTER&#039;s gaze grows distant for several moments. With the grace of a doe lapping water at a brook, her gaze falls to TARGET and a rush of energy briefly flows between them causing TARGET to return to life.&amp;lt;section end=Imaera 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Emptying all breathe from your body, you slowly still yourself and close your eyes. You reach out with all of your senses and feel a film shift across your vision. Opening your eyes, you gaze through a white haze and find images of TARGET floating above his prone form. Acts of TARGET&#039;s past, present, and future play out before your clouded vision. With conviction and faith, you pluck a future image of TARGET from the air and coax he back into his body. Slowly, the film slips from your eyes and images fade away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Slowly exhaling the last syllable of his chant, CASTER closes his eyes for several moments. Upon opening his eyes, hundreds of images appear to hover over the prone form of TARGET. Each image is different from that of the woman that lays lifeless. With firm conviction, CASTER pulls at one of the images in the air and slowly coaxes TARGET&#039;s ghostly form back into her body. The film slips from CASTER&#039;s eyes as TARGET is filled with the breath of life. &amp;lt;section end=Jastev 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Deep and resonating, you feel the chant that falls from your lips instill within you with the strength of your faith.  You crouch beside (TARGET) and gently lift him into your arms, your muscles swelling with the power of your deity, and cradle him close to your chest.  Strength and life momentarily seep from your limbs, causing them to feel laden and heavy, and you are overcome with a sudden weakness.  With a sigh, you are able to lay (TARGET) back down.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Deep and resonating, you feel the chant that falls from her lips and watch as she is filled with the strength of her faith. She crouches beside TARGET and gently lifts him into her arms. CASTER&#039;s muscles swell with the power of her deity, and she cradles him close to her chest. Strength and life flood from CASTER&#039;s body into TARGET&#039;s, but CASTER suddenly seems weakened by the experience and is forced to her knees. With a soft sigh, CASTER still manages to lay TARGET gently back down. &amp;lt;section end=Kai 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; With each passing moment during your slow chant, the thrum of power begins to flood your very being, pulsing through your veins like crackling electricity. The overwhelming sensation liberates your mind from the trivial details of mortal life. You fold your right arm over and rest your chin upon your hand while gazing down at the lifeless corpse of TARGET, contemplating his existence. Blinking once, you thrust your hand over TARGET, and the raw power escapes your body through your fingertips, flowing into him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; With each passing moment during CASTER&#039;s slow chant, his eyes flutter rhythmically. He folds his right arm and rests his chin upon his hand, then gazes down at you, as if contemplating your very existence. Blinking once, CASTER thrusts his hand over you, and crackling, raw power flows from CASTER&#039;s fingertips into your body, jolting you back to life.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; With each passing moment during CASTER&#039;s slow chant, his eyes flutter rhythmically. He folds his right arm and rests his chin upon his hand, then gazes down at the lifeless corpse of TARGET, as if contemplating his existence. Blinking once, CASTER thrusts his hand over TARGET, and crackling raw power flows from CASTER&#039;s fingertips into TARGET. &amp;lt;section end=Koar 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Thin at first, a fine layer of rime tickles your hands and fingertips. The hoarfrost smoothly glides between you and TARGET, turning to a light powder as it traverses the space between. The white substance clings to TARGET&#039;s eyelashes and cheeks for a moment before it becomes charged with spiritual power, then it slowly melts away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Thin at first, a fine layer of rime coats CASTER&#039;s hands and fingertips. The hoarfrost smoothly glides across the space between CASTER and TARGET, turning to a light powder in the open air. The white substance clings to TARGET&#039;s eyelashes and cheeks for a moment before it becomes charged with spiritual power, then it slowly melts away. &amp;lt;section end=Lorminstra 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Lifting your finger, you begin to chant and draw a series of conjoined circles in the air. Each circle turns to mist and takes on a different hue - white, blue, black, red, and green. As the last ring is completed, you spread your fingers and gently allow your tips to touch each color before pushing the misty creation towards TARGET. A shock of energy courses through your body as the mist seeps into TARGET&#039;s chest and life is slowly returned to his body.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Lifting her finger, CASTER begins to chant and draws a series of conjoined circles in the air. Each circle turns to mist and takes on a different hue - white, blue, black, red, and green. As the last ring is completed, she spreads her fingers and gently allows the tips to touch each color and pushes the misty creation towards Body. A shock of energy courses through CASTER&#039;s body as the mist seeps into TARGET&#039;s chest and life is slowly returned to his body. &amp;lt;section end=Lumnis 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Rich and lively, the scent of wild flowers suddenly fills the air as you finish your chant, and you feel alive with the energy of spring. With renewal at your fingertips, you gently touch TARGET on the brow and revel in the sweet rush of energy that passes through you into her.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Rich and lively, the scent of wild flowers suddenly fills the air as CASTER finishes her chant, and an aura of energy forms a rose-hued nimbus around herself. Lifting his fingers, CASTER gently touches TARGET&#039;s brow and the nimbus drains away from CASTER as it fills TARGET with life. &amp;lt;section end=Oleani 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; A pleasant warmth encircles CASTER&#039;s body with a golden nimbus that is reminiscent of a rising sun, her features softened by its presence. As she lifts her right palm you notice a fierce energy fill her hand. The light, driven by CASTER&#039;s will, slants in thin lines from her hand across your face and fills you with the vigorous life of a burning sun.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Phoen 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Weaving your hands as you speak the words of your prayer, you are momentarily mesmerized by the silver nimbus that your movements create. The world around you takes on a dream-like quality and the nimbus at your fingertips turns into the image of a slender blade. Grasping it by the hilt, you plunge the silver light into TARGET&#039;s chest and feel the shock of impact tear the blade from your hands. As TARGET draws the breath of life into her lungs, the blade becomes ethereal and disperses into the air.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Weaving his hands as he speaks the words of his prayer, CASTER is momentarily mesmerized by the silver nimbus that his movements create.  The world around you takes on a dream-like quality and the nimbus at CASTER&#039;S fingertips turns into the image of a slender blade.  Grasping it by the hilt, CASTER plunges the silver light into your chest and you feel the shock of its impact fill you with life.  As you draw breath into your lungs, the blade becomes ethereal and disperses into the air.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Weaving her hands as she speaks the words of her prayer, CASTER is momentarily mesmerized by the silver nimbus that her movements create. The world around you takes on a dream-like quality and the nimbus at CASTER&#039;s fingertips turns into the image of a slender blade. Grasping it by the hilt, CASTER plunges the silver light into TARGET&#039;s chest and the shock of its impact fills TARGET with life. As TARGET draws her first breath, the blade becomes ethereal and disperses into the air. &amp;lt;section end=Ronan 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A golden light surrounds your fingers as you weave an intricate pattern above TARGET&#039;s body.  The fluid movement of your hands grows faster and faster with each passing moment, until they are nothing but a glowing blur.  Ethereal coins materialize out of nowhere, clinking melodically together as they fall toward TARGET.  You quickly snatch them out of mid-air with a single hand, and begin flipping them playfully at him, whose body quickly absorbs the coins.  Each coin brings more color and warmth, until the final toss elicits a gasp of breath from TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; A golden light surrounds CASTER&#039;s fingers as he weaves an intricate pattern above your body.  The fluid movement of his hands grows faster and faster with each passing moment, until they are nothing but a glowing blur.  Ethereal coins materialize out of nowhere, clinking melodically together as they fall toward you.  CASTER quickly snatches them out of mid-air with a single hand, and begins flipping them playfully at you.  Your body greedily absorbs each coin, bringing more warmth to your being, until the final toss elicits an impulsive gasp of air as your life is renewed.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; A golden light surrounds CASTER&#039;s fingers as he weaves an intricate pattern above TARGET&#039;s body.  The fluid movement of his hands grows faster and faster with each passing moment, until they are nothing but a glowing blur.  Ethereal coins materialize out of nowhere, clinking melodically together as they fall toward TARGET.  CASTER quickly snatches them out of mid-air with a single hand, and begins flipping them playfully at TARGET, whose body quickly absorbs the coins.  Each coin brings more color and warmth, until the final toss elicits a gasp of breath from TARGET.&amp;lt;section end=Tonis 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A feeling of deep lassitude overcomes you as your lips part in a soft chant that is no louder than a gentle purr. Deep within your body you feel as though something is stretching languidly and slowly waking. The world takes on a black and white hue as another, deeper purr joins your own and at its climax you touch TARGET on the forehead. You feel a deep contentment at the exchange of raw power that your touch causes within his, and you feel the cat within return to quiet slumber; the experience leaving you to feel slightly weakened.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Shadows shift and roll around CASTER as his lips part in a soft chant that is no louder than a gentle purr. Taking on definition and contrast, the shadows around CASTER morph into the semblance of a large feline stretching languidly and his eyes take on a yellow cast as he gazes at you. A deeper, louder purr accompanies CASTER&#039;s as he touches your forehead and the feeling of raw power that burst over you blinds you. When your vision clears the shadows are long and his eyes have returned to normal.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Andelas 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Weaving your hands into a complex gesture, you feel a power begin to fill your very being, and in your peripherals you see the dark hue of licking flames.  You narrow your eyes so that only TARGET&#039;s prone form is in your field of vision.  The last syllable of your spell falls from your lips, a sharp command at the soul beyond the lifeless body, and you feel raw energy course through you into TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Raw energy spills from the shadows that ring CASTER as she begins to weave her hands in complex gestures above you. Narrowing her eyes, Savior issues a sharp command at your spirit as it floats above your body, then you feel yourself slam back into your mortal shell.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Weaving his hands in complex gestures, CASTER begins to cast his spell and you notice that the shadows lengthen around him. CASTER narrows his eyes, his gaze falling upon TARGET, and issues one sharp command. Raw energy passes between the two and the shadows return from whence they came. &amp;lt;section end=Eorgina 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you begin to chant you notice the scent of dry, dusty parchment and feel a cool mist cling to your skin somewhere near your feet. You sense the ethereal tendrils of the mist as they coil about your body and notice that the world turns to a yellowish hue as the mist settles about your head. Focusing on TARGET, you feel the transfer of energy pass between you as you return him to life.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As CASTER begins to chant the scent of dry, dusty parchment fills the air and a topaz mist wreathes her body. The coiling, ethereal tendrils circle about her and slowly rise from her feet to her head where they form a slit-eye. The eye opens, its focus upon TARGET and a surge of energy passes between the two. &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Rolling green mist seeps from your skin and glides across your fingertips only to swirl through the air toward TARGET.  As the mist connects to his prone form, you feel a surge of power dance across your skin and watch as he writhes beneath its erratic gyrations.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Rolling green mist seeps from CASTER&#039;s skin and glides across her fingertips only to swirl through the air towards you.  As the mist connects with your prone form, you feel a surge of power igniting your flesh and you writhe beneath its erratic gyrations.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Rolling green mist seeps from CASTER&#039;s skin and glides across her fingertips only to swirl through the air towards TARGET. As the mist connects with the prone form, a surge of power can be seen dancing across his skin and his writhes beneath its erratic gyrations. &amp;lt;section end=Ivas 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you begin to chant the air about you takes on the musty scent of an ophidian being shedding its skin and an emerald light clings to your skin. You feel the ethereal tendrils twining around your arms forming slender asps, which punctuate the words of your prayer with their hiss. Pointing towards TARGET, you feel the mist slither off of your arms and watch them slam into her chest at the exact moment that you feel your energy transfer into her.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As CASTER begins to chant, the air fills with the musty scent of coiling serpents and a mist of emerald light clings to his arms. The ethereal tendrils briefly seem to coil into the shape of asps, which suddenly strike out at TARGET and infuse her with CASTER&#039;s energy. &amp;lt;section end=Luukos 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Murmuring softly, you call upon your connection with the Destroyer and feel your words twist into an alien, spidery chant. Dark shadows laced with crimson swirl before your eyes and at your forceful command sink into the chest of TARGET. The transference of energy is swift and immediate as you bind TARGET back into his body.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Murmuring softly, CASTER calls out in a harsh, voice that slowly dwindles to an alien chant difficult to follow.  Rising from the ether on the heels of his harsh command, a pair of dark shadows infused with crimson light slam into your chest and infuses you with the raw energy of life.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Murmuring softly, CASTER calls out in a harsh, commanding voice that slowly dwindles to an alien chant difficult to follow. Circling darkly around CASTER&#039;s body is a series of dark shadows infused with a crimson light. Suddenly, he issues a forceful, sharp command that sends the shadows crashing into TARGET&#039;s chest. &amp;lt;section end=Marlu 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Murmuring softly, a mournful chant slips from your lips and you feel welts appear upon your wrists. Dipping them briefly, you smear the crimson liquid the leaks from these sudden wounds in a thin line down TARGET&#039;s face. Tingling with each second that your skin touches his, you feel the transference of your raw energy pass into TARGET and momentarily reel with the pain of its release. Slowly, the wounds on your wrists heal, though a lingering throb remains.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Murmuring softly, a mournful chants slips from CASTER&#039;s lips and crimson rents appear upon his wrist. Dipping them briefly, CASTER smears the crimson liquid that leaks from his wounds in a thin line down your face and the warm rawness of the life begins to bleed into you. The pain of renewal is almost as sharp as the rawness of the energy that suddenly fills you. Slowly, though you are dazed, you watch the wounds upon CASTER&#039;s wrists heal.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Murmuring softly, a mournful chant slips from CASTER&#039;s lips, and crimson rents appear upon her wrists.  Dipping them briefly, CASTER smears the crimson liquid that leaks from her wounds in a thin line down TARGET&#039;s face.  The transference of energy between the pair is immediate and the air crackles with the rawness of its release.  Slowly, the wounds upon CASTER&#039;s wrists heal. &amp;lt;section end=Mularos 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Low and monotonous, you begin a chant to draw TARGET back to life and feel the deep shadows of the area rise to meet you. Falling upon you like a cloak of darkness, the twisting, inky blackness transforms into the visage of a jackal from a once forgotten nightmare. Sweeping from your body into TARGET&#039;s, the raw energy of your prayer transfers into her prone form. Slowly, the shadows recede back into the surrounding area.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Low and monotonous, CASTER begins to chant and the deep shadows of the area seem to rise to meet him. Falling upon him like a mantle of darkness, the twisting, inky blackness transforms into the visage of a jackal from a once forgotten nightmare and sweeps from CASTER&#039;s body into TARGET. Slowly, the shadows recede back into the surrounding area. &amp;lt;section end=Sheru 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Harsh and barbaric, the words of CASTER&#039;s chant fall from his lips and disappear upon the air that surrounds you.  Darkness descends upon your vision, changing the world to sanguine hues, and you watch as an unholy rage fills CASTER&#039;s face.  Suddenly blinded by the berserker frenzy that fills him, he lashes out at you, and the raw energy of his fury restores you to life.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Harsh and barbaric, the words of CASTER&#039;s chant fall from his lips and disappear upon the surrounding air. Blood fills his eyes, and his face transforms into a mask of unholy rage as he stares down at TARGET&#039;s prone form. Suddenly blinded by the berserker frenzy that fills him, CASTER lashes out at TARGET and the air crackles with the raw energy of his fury as it restores her to life. &amp;lt;section end=V&amp;amp;#39;tull 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Wrapped in an aura of chill, you close your eyes and softly begin to chant. As the cold air that surrounds you condenses you feel it slowly ripple outward in waves that turn the breath of those nearby into a fine mist. This mist swiftly moves to encompass you and you feel a pair of wings arc over your back. With the last words of your chant, you open your eyes and watch as foggy wings rise above you and gently brush against TARGET. As they dissipate in a cold rush against TARGET, you feel a surge of power spill forth from you and into him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Wrapped in an aura of chill, CASTER closes his eyes and softly begins to chant.  As the cold air that surrounds him condenses it begins to ripple outward in waves that turns the breath of those nearby into a fine mist.  This mist swiftly moves to encompass CASTER and slowly coalesces into a pair of ethereal wings that settle into a protective arc over you.  With the last words of his chant, the wings surge forward and gently caress you.  You feel a surge of power lance forth from CASTER into you, and moments later the fog dissipates, taking the chill of the air with it.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Wrapped in an aura of chill, CASTER closes her eyes and softly begins to chant. As the cold air that surrounds her condenses it beings to ripple outward in waves that turns the breath of those nearby into a fine mist. This mist swiftly moves to encompass CASTER and slowly coalesces into a pair of ethereal wings that settle into a protective arc over TARGET. With the last words of her chant, the wings surge forward and gently caress TARGET, only to dissipate moments later taking the chill of the air with it. &amp;lt;section end=Gosaena 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Silvery and light, your eyes glaze over with a wild, crazed view of the world around you. A strange giggle passes your lips of its own volition as you gaze at TARGET&#039;s prone form. As if the carefree sound becomes something visible and substantial, the air around TARGET shimmers silvery and raw, as spiritual energy flows from you into hers.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Silver and light, CASTER&#039;s eyes take on a wild, crazed sheen. Her gaze falls upon you and a strange giggle passes from her lips. The laughter swells upon the air and as the carefree sound falls upon you it seems to swell and gain substance, filling you with its raw, as silvery spiritual energy.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Zelia 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Chanting softly, you begin to feel the gentle patter of rainfall upon your skin and smell the rich scent of loam fill the air. Lightly brushing your fingertips against TARGET&#039;s brow, you feel a warm rush of energy thrum through your feet and rise up through your body only to be transferred through your finger tips into her prone form.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Aeia 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Guttural and primal, the words of CASTER&#039;s chant are torn from CASTER&#039;s throat with enough force to slice the very air. He clenches his hands into tight fists and within moments blood begins to seep from between his fingers. Bending at the waist, CASTER opens his hands and presses his right hand to TARGET&#039;s forehead, and the other to his lips. Power surges through the connected bodies and within moments TARGET draws his first breath of life. &amp;lt;section end=Amasalen 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Low and soft, the chant that falls from CASTER&#039;s lips is suddenly transformed into a sound that resembles the gentle clattering of thousands of tiny feet as they scuttle across a marble floor. Waving his hands over you, you notice that tiny threads of spider silk are leaking from his fingertips, and you realize that you are being blanketed in a cocoon. Moments later, you feel the webbing seep into your skin, and with it comes a feeling of raw energy, which shocks you back into life. As you draw your first breaths, the webbing seems to have completely dissolved.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Arachne 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you begin your forceful incantation, you feel a dampness laden your limbs, and your vision blurs with a silvery grey mist.  Controlled movements bring the mist under your control, and it begins to take shape as an indigo eel with silvery-grey eyes.  Once fully formed, you thrust the anguillid at TARGET&#039;s lifeless body and watch as it swims in a sinuous dance around him for several moments.  With a final twisting movement, the eel latches onto its own tail and sinks into TARGET&#039;s skin.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; As CASTER begins his forceful incantation a silvery grey mist begins to seep from his eyes and clings, damply, to his skin.  Controlled movements bring the mist under his control, and it begins to take shape as an indigo eel with silvery-grey eyes.  Once fully formed, CASTER thrusts the anguillid at your lifeless body and watches as it swims in a sinuous dance around you for several moments.  With a final twisting movement, the eel latches onto its own tail and sinks into your skin.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As CASTER begins his forceful incantation a silvery grey mist begins to seep from his eyes and clings, damply, to his skin.  Controlled movements bring the mist under his control, and it begins to take shape as an indigo eel with silvery-grey eyes.  Once fully formed, CASTER thrusts the anguillid at his lifeless body, and you watch as it swims in a sinuous dance over his skin for several moments.  With a final twisting movement, the eel latches onto its own tail and sinks into his skin with a clammy wetness. &amp;lt;section end=Ghezresh 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Crouching beside the prone form of TARGET, you softly issue the last syllable of your chant. Breathing deeply, you take in the scents around you and let the feel of your surroundings infuse you. With only your gaze, you track the area and recreate the circumstances of TARGET&#039;s death within your mind. Touching TARGET, you follow the lines of the web that holds his soul in place and force it back into his body. Raw energy courses through you and you feel your sense of justice and vengeance filling TARGET with life.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Crouching beside your prone form, CASTER softly issues the last syllables of his chant and takes a deep breath. Calmness steals over his features, and as he lifts his eyes to the surroundings, you are reminded of a wild animal tracking its prey. Slowly, and with deliberate movement, CASTER&#039;s gaze slips over your body and you feel him reach out to you. With force, CASTER slams your soul back into your body and the transference of raw energy that brings you back to life is filled with justice and vengeance.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Crouching beside TARGET&#039;s prone form, CASTER softly issues the last syllables of his chant and takes a deep breath. Calmness steals over his features, and as he lifts his eyes to the surroundings, you are reminded of a wild animal tracking its prey. Slowly, and with deliberate movement, CASTER&#039;s gaze slips over TARGET&#039;s body and you watch as he plucks something that only he can see from the air. With force, CASTER slams his fist into TARGET&#039;s body and the raw energy transfers between them is filled with justice and vengeance &amp;lt;section end=The Huntress 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Kneeling beside the prone form of TARGET, you utter the last syllable of your chant and lower your face to xx&#039;s ear. Whispering softly, you speak unto her, &amp;quot;With the air in my lungs, I bring you back from death. With the power of Jaston, I draw you into breath.&amp;quot; Slowly, you exhale upon TARGET&#039;s face, and you feel the gentle pull of the four winds carry your breath over every inch of her body. Standing, you feel the raw energy granted to you by your deity transfer into xx, and it momentarily steals your breath away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Jaston 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; You chant slowly as you walk a slow circle around the body of TARGET, shimmering flowers and herbs winking into existence. The gentle fragrance of an herb garden rises underfoot, flooding your senses and setting your skin tingling with the power of life. You lean over and pluck an ethereal leaf, placing it on TARGET&#039;s forehead. As it sinks into her skin, the garden around her grows higher and lusher, covering TARGET in blanket of calm, yet revitalizing energy.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER chants slowly as she walk a slow circle around your body, shimmering flowers and herbs winking into existence. She leans over and plucks an ethereal leaf, placing it on your forehead. Sensation begins to return to your body as it sinks into your skin, and you can feel the gentle caress of calm energy blanketing you as the surrounding garden grows higher and lusher.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Kuon 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As the last syllable of your chant falls from your lips, you feel the need to hum come over you. The soft lullaby that issues from your throat reminds you of young loves that were lost before they had a chance to blossom. Gazing down at TARGET&#039;s prone form, you feel a deep connection between the light tune you hum and the loss of the life before you. Channeling your energy toward TARGET, you implore him to return to his body and rejoin the living so that others do not feel that loss.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER chants softly, his words blending one into the other until the chant becomes a soft lullaby.  Delicate and light, the tune reminds you of young loves that were lost before they had a chance to blossom.  Turning his gaze down upon your prone form, you feel the power of his song overcome you, imploring you back into life so that others do not feel the loss that his song reminds you of.  So cajoled, you return to your body with a sudden gasping of breath&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;CASTER chants softly, his words blending one into the other until the chant becomes a soft lullaby.  Delicate and light, the tune reminds you of young loves that were lost before they had a chance to blossom.  Turning his gaze down upon TARGET&#039;S prone form, you feel the power of CASTER&#039;S song fall like a wave upon TARGET.  Within moments, TARGET draws her first breath of life. &amp;lt;section end=Laethe 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Releasing all of the air from her body, CASTER lets the last syllables of her chant fall from her lips and you watch her grow perfectly still. Narrowing the focus of her attention to TARGET&#039;s lifeless form, CASTER shifts her stance and carefully lays her hand upon his forehead. Slowly, a deep blue nimbus begins to glow around CASTER&#039;s body, and as she withdraws her hand from TARGET&#039;s forehead, you notice that the glowing light begins to seep into the dagger-shaped brand seared upon it. Moments later, TARGET draws breath and the brand upon his forehead disappears. &amp;lt;section end=Leya 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; You weave your hands in a fluid pattern before you, matching the tempo of your soft incantation. The subtle scent of the ocean tickles your nose as power rises within your being like the day&#039;s tide. With a wide smile, you caress TARGET&#039;s cheek before placing your hand above her heart. Wisps of rainbowed energy flow from your fingertips and into the body of TARGET, washing over her and rescuing her from the clutches of the abyss.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CLERIC weaves her hands in a fluid pattern that matches the tempo of her soft incantation.  The subtle scent of the ocean flows in as CLERIC tenses momentarily.  With a wide smile, CLERIC caresses your cheek before placing her hand above your heart.  Wisps of rainbowed energy flow from CLERIC&#039;s fingertips and into your body, washing over you like the lapping waters of the warm southern seas, rescuing you from the darkness of death.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Niima 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Almost imperceptible, you chant solemnly before TARGET, and the air around your hands begins to shimmer. Materializing out of nothingness, menacing shadows can be seen clinging to TARGET&#039;s cold body. With surgical precision, you strike at each dark tendril with a single finger, cutting them away from him. Slowly, you draw a single line across TARGET&#039;s neck, releasing him from the last bond of death.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Almost imperceptible, CLERIC chants solemnly before you, and the air around his hands begins to shimmer.  Materializing out of nothingness, menacing shadows can be seen clinging to your cold body.  With surgical precision, CLERIC strikes at each dark tendril with a single finger, cutting them away from you.  Slowly, he draws a single line across your neck, releasing you from the last bond of death.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Onar 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A melodic chant escapes your lips, singing the praises of the joys of living.  Rising up from within your very soul like an unforgettable melody, a sparkling yellow aura soon surrounds you as you revel in your ceremony.  Caught up in the moment, you dance lively around the body of TARGET, the exultant energy flowing from you to her with every step.  You take a small bow at the end of the ritual that has left both you and TARGET slightly out of breath.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; A melodic chant escapes CASTER&#039;s lips, singing the praises of the joys of living.  CASTER&#039;s eyes light up, and a sparkling yellow aura soon surrounds her as she revels in her ceremony.  Caught up in the moment, she dances lively around your body, the exultant energy flowing from her to you with every step.  CASTER takes a small bow at the end of the ritual that has left both her and you slightly out of breath.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; A melodic chant escapes CASTER&#039;s lips, singing the praises of the joys of living.  CASTER&#039;s eyes light up, and a sparkling yellow aura soon surrounds her as she revels in her ceremony.  Caught up in the moment, she dances lively around the body of TARGET, the exultant energy flowing from her to TARGET with every step.  CASTER takes a small bow at the end of the ritual that has left both her and TARGET slightly out of breath. &amp;lt;section end=Tilamaire 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Lowering your eyes solemnly to TARGET&#039;s prone form, you utter the last syllable of your chant and are struck by the sudden, overpowering scent of roses. Gently laying your hand over TARGET&#039;s heart, you softly pour your energy into his form and implore he to return to life, love, and the acceptance of those around he. You feel your connection with TARGET grow as your energy fills his heart and are relieved to feel a pulse beneath your hands.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Lowering his eyes solemnly to you, CASTER utters the last syllable of his chant and you suddenly recognize the overpowering scent of roses on the air. Gently laying his hand upon your heart, you begin to feel your body again. Life, love, and the acceptance of all around you draws your soul back towards your body and within moments you feel the raw energy ignite your heartbeat and return you to life.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Lowering her eyes solemnly to TARGET, CASTER utters the last syllable of her chant and you suddenly recognize the overpowering scent of roses on the air.  Gently laying her hand upon TARGET&#039;s heart, you feel a strengthening of the energy between the two.  Within moments, you can audibly hear the sound of TARGET&#039;s heart. &amp;lt;section end=Voaris 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Gazing grimly upon the body of TARGET, CASTER chants with a quiet determination to intervene in TARGET&#039;s fate. Determination fills CASTER&#039;s face and he summons gossamer white energy around his hands. CASTER clutches his fist over his heart and then places his hand above TARGET&#039;s lifeless eyes. His once quiet chant grows stronger and louder as the energy rushes forth from his fingertips and into TARGET. &amp;lt;section end=Voln 318 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Unaligned===&lt;br /&gt;
;Other &amp;lt;section begin=Other 318 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A brilliant glow forms around TARGET, lingers for a moment, then fades. Your surroundings grow dim...you lapse into a state of awareness only, unable to do anything...&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;A bolt of soft white light streaks down from the sky bathing TARGET in it. A brilliant glow forms around TARGET, lingers for a moment, and finally fades.  TARGET awakens looking somewhat confused and seriously drained. &amp;lt;section end=Other 318 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Ethereal Censer (320)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 320 /&amp;gt;&lt;br /&gt;
:Mana swirls into the visible spectrum and manifests as an ethereal, sea blue censer swinging pendulously through the air beside you.  A emerald haze of incense smoke trails in its wake, quickly spreading in sinuous tendrils through the area. &amp;lt;section end=Charl 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Charl 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 320 /&amp;gt;&lt;br /&gt;
:Mana swirls into the visible spectrum and manifests as an ethereal, pale golden censer swinging pendulously through the air beside you.  A brown haze of incense smoke trails in its wake, quickly spreading in sinuous tendrils through the area. &amp;lt;section end=Eonak 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Imaera 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Jastev 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Kai 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Koar 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Lorminstra 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Lumnis 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Oleani 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Phoen 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ronan 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Tonis 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Andelas 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Eorgina 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ivas 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Luukos 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Marlu 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Mularos 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Sheru 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=V&amp;amp;#39;tull 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 320 /&amp;gt;&lt;br /&gt;
:Mana swirls into the visible spectrum and manifests as an ethereal, silver censer swinging pendulously through the air beside you.  A green haze of incense smoke trails in its wake, quickly spreading in sinuous tendrils through the area. &amp;lt;section end=Gosaena 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Zelia 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Aeia 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Amasalen 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Arachne 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ghezresh 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=The Huntress 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Charl 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Kuon 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Laethe 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Leya 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Onar 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Niima 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Tilamaire 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Voaris 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Voln 320 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 320 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Other 320 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Intercession]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl Intercession /&amp;gt;&lt;br /&gt;
:an opague emerald trident talisman&lt;br /&gt;
:Thunder breaks overhead with a deafening roar, and you are assaulted by the sharp scent of seawater. Blue sparks leap up from the ground, leaving jagged afterimages hovering in your vision for several moments after the lights themselves are gone. &amp;lt;section end=Charl Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen Intercession /&amp;gt;&lt;br /&gt;
:an iridescent pyrite lute talisman&lt;br /&gt;
:Strains of music pluck at your ears, woven through with the sound of a distant voice raised in joyous laughter. Your heart grows light, the world more colorful to your eyes. In moments, the distant sounds fade and leave you energized in the wake of their merriment. &amp;lt;section end=Cholen Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak Intercession /&amp;gt;&lt;br /&gt;
:a polished stone anvil talisman&lt;br /&gt;
:The earth shifts almost imperceptibly beneath your feet, becoming somehow more solid, more supporting.  Your ears ring with the sharp sound of metal on metal, but the tone is faint and hollow, heard as though from a great distance.  A moment later, the distant hammering fades away. &amp;lt;section end=Eonak Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera Intercession /&amp;gt;&lt;br /&gt;
:a dusky carved amber doe talisman&lt;br /&gt;
:A multitude of scents assault you, rich and earthy, clean and fresh.  Faint sparks of green and golden light drift on the air, drawn toward you in a lazy spiral.  Where they alight, your flesh tingles and itches with a wild energy.  After a moment, the sparks wink out of existence, taking the heady odors with them. &amp;lt;section end=Imaera Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev Intercession /&amp;gt;&lt;br /&gt;
:a spherical alexandrite pendant&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Jastev Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai Intercession /&amp;gt;&lt;br /&gt;
:a carved silver tigerfang fist symbol&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Kai Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar Intercession /&amp;gt;&lt;br /&gt;
:a rich golden topaz crown talisman&lt;br /&gt;
:The air about you fills with a harsh light, every line you view through it sharply defined. A commanding and implacable gaze weighs heavily upon you, humbling you even as it fills you with a quiet pride. The sensation of being watched passes, but in its wake you are stronger and more firm in your resolve. &amp;lt;section end=Koar Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra Intercession /&amp;gt;&lt;br /&gt;
:a gold-traced banded onyx key symbol&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Lorminstra Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis Intercession /&amp;gt;&lt;br /&gt;
:a multicolored agate scroll pendant&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Lumnis Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani Intercession /&amp;gt;&lt;br /&gt;
:a pale pink morganite rose pendant&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Oleani Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Pheon Intercession /&amp;gt;&lt;br /&gt;
:a brilliant golden sunburst talisman&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Phoen Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan Intercession /&amp;gt;&lt;br /&gt;
:a silver-edged jet sword symbol&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ronan Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis Intercession /&amp;gt;&lt;br /&gt;
:a golden jasper Pegasus talisman&lt;br /&gt;
:A shimmer of gold streaks across your vision, rising upward and fading from view.  For just a moment, your ears catch the distant beating of great wings and a staccato crackle of flame. &amp;lt;section end=Tonis Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas Intercession /&amp;gt;&lt;br /&gt;
:a dusky chrysoberyl cat symbol&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Andelas Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina Intercession /&amp;gt;&lt;br /&gt;
:a stylized firestone flame pendant&lt;br /&gt;
:Dark colors, shadowy yet jewel-bright, waver in the air about you, swirling and melting in an ever-changing tapestry of ghostly luminescence.  A velvety soft touch alights on your neck, wordlessly promising guidance, but the contact swiftly grows as cold and hard as steel.  It forces you down, pushing you lower, enforcing your submission with sheer power, but still the dusky play of colors dances on the air.&lt;br /&gt;
:That powerful touch fades after a moment, as does the vision of so many reflected colors.&amp;lt;section end=Eorgina Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae Intercession /&amp;gt;&lt;br /&gt;
:a mottled citrine eye talisman&lt;br /&gt;
:A line of yellow light flows outward from your feet, tracing a pattern of growing intricacy on the air just above the ground. The light branches a multitude of times, each strand writhing in place as though barely held in check by some unseen power.&lt;br /&gt;
:The threads of glowing amber loop back upon themselves, throwing silver sparks as their ends merge. The image of a stylized slit-pupiled eye completes itself and burns, sourceless, on the air about you for the space of a breath before vanishing into nothing. &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas Intercession /&amp;gt;&lt;br /&gt;
:a milky green jade smoke wisp&lt;br /&gt;
:Heat blooms at the core of your being, roiling outward to burst against your skin in a froth of sudden goosebumps.  A curling wisp of smoke escapes your lips as you exhale, dispersing quickly, but you are left with a deep-seated sense of satisfaction. &amp;lt;section end=Ivas Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos Intercession /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Luukos Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu Intercession /&amp;gt;&lt;br /&gt;
:a glossy black star diopside talisman&lt;br /&gt;
:A spot of darkness in your vision blooms hazily outward, rippling as it does so with deep violets and sickly greens. Six slender tentacles unfold from the heart of that writhing blackness, barely paler than the void that surrounds them, and form a slowly undulating star. After a moment, the darkness wavers and shreds, sending wisps of shadow curling away into nothing. &amp;lt;section end=Marlu Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos Intercession /&amp;gt;&lt;br /&gt;
:a bloodstone impaled heart symbol&lt;br /&gt;
:Needles of power stab into you, sending white-hot pain coursing through your body. Sorrow fills your heart, but with it comes acceptance, an overwhelming sense of rightness that stays with you even as the agony fades to a dull ache in your chest. &amp;lt;section end=Mularos Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru Intercession /&amp;gt;&lt;br /&gt;
:an iron-rimmed amber jackal talisman&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Sheru Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull Intercession /&amp;gt;&lt;br /&gt;
:a black iron scimitar talisman&lt;br /&gt;
:Shadows flood your vision and tinge everything you see a faint bloody red. The clash of battle fills your ears, punctuated by the cries of the dying. Your vision clears in moments and the riotous noises fade to nothing, but you are left with a righteous sense of purpose. &amp;lt;section end=V&amp;amp;#39;tull Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena Intercession /&amp;gt;&lt;br /&gt;
:a slender silver sickle talisman&lt;br /&gt;
:A stillness steals over you, distancing you from yourself. A soothing peace seeps outward from your core and strips away the clamor of daily living. Sounds fade away, divorced from their meaning in the cool grip of complete and utter silence. In moments, the silence is broken as though it never was, but though that crystalline quietude passes on, the peace it imparted remains. &amp;lt;section end=Gosaena Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia Intercession /&amp;gt;&lt;br /&gt;
:a pale crescent moonstone pendant&lt;br /&gt;
:Lights race across your vision, shifting and merging as they flee faster and faster. Crescents flow into full moons and back again, clouding over with crimson whorls before glowing a brilliant white. The sight is highly disorienting, leaving you dizzy from your attempts to track their movement. A dark speck arcs across a crazily spinning ruby dot just before all the lights vanish into silvery smoke, which lazily drifts away. &amp;lt;section end=Zelia Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia Intercession /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Aeia Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen Intercession /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Amasalen Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne Intercession /&amp;gt;&lt;br /&gt;
:an onyx and garnet spider talisman&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Arachne Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh Intercession /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ghezresh Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress Intercession /&amp;gt;&lt;br /&gt;
:an eight-tined lapis star symbol&lt;br /&gt;
:Anger surges through you, boiling up from within and threatening to burst into violence. You bring your rage under control through sheer force of will and are rewarded by a growing sense of purpose. Though the unnaturally strong emotion drains away in minutes, your newly-won focus remains. &amp;lt;section end=The Huntress Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston Intercession /&amp;gt;&lt;br /&gt;
:a translucent quartz feather talisman&lt;br /&gt;
:The air thrums with the sound of beating wings.  A spill of pale feathers swirl across your vision, curling about you before scattering in all directions and vanishing into nothing. &amp;lt;section end=Jaston Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon Intercession /&amp;gt;&lt;br /&gt;
:a greenish gold zircon leaf symbol&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Kuon Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe Intercession /&amp;gt;&lt;br /&gt;
:a delicate black onyx rose symbol&lt;br /&gt;
:A dull ache builds in your chest, filling you with formless sorrow and bringing tears to your eyes.  The pain eases after a moment, borne away on a calming river of peace. &amp;lt;section end=Laethe Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya Intercession /&amp;gt;&lt;br /&gt;
:a chalcedony dagger talisman&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Leya Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima Intercession /&amp;gt;&lt;br /&gt;
:a smooth white opal dolphin pendant&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Niima Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar Intercession /&amp;gt;&lt;br /&gt;
:a deathstone skull talisman&lt;br /&gt;
:Darkness flickers at the edge of your vision, and a light touch brushes your neck, the briefest caress of bone-chilling cold.  A thread of numbness follows in its wake, but it is fleeting, and feeling returns in a warm rush. &amp;lt;section end=Onar Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire Intercession /&amp;gt;&lt;br /&gt;
:a labradorite musical note symbol&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Tilamaire Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris Intercession /&amp;gt;&lt;br /&gt;
:a crystalline yellow rose symbol&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Voaris Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln Intercession /&amp;gt;&lt;br /&gt;
:a pure white onyx shield talisman&lt;br /&gt;
:Cold, white light floods your mind, forming a near-solid barrier about your thoughts. Strength courses through your body, bringing with it new resolve and a firm sense of the righteousness of your cause. &amp;lt;section end=Voln Intercession /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Unaligned===&lt;br /&gt;
;Other &amp;lt;section begin=Other Intercession /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Other Intercession /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Divine Wrath (335)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Charl, you know that you are heard. A briny gust of sea breeze swirls around you, infusing the air with the scent of the sea and droplets of saltwater.&lt;br /&gt;
::A deafening thunderclap splits the air! Rather than fading away, the sound&#039;s echoes grow, and they gather into a rhythmic, crashing pulse like the sound of storm-tossed waves breaking on a desolate shore. The power of Charl has answered your prayer.&lt;br /&gt;
::The sounds of crashing waves increase to an almost deafening level until, suddenly, a powerful wave surges into the area, violently slamming directly into TARGET.&lt;br /&gt;
::White sparks flicker around you, and you sense electrical energy gathering in the instant before a massive bolt of lightning spears toward TARGET.&lt;br /&gt;
::A final rumble of thunder rolls through the area, and, as its last echoes fade away, your skin ceases to tingle as your connection to Charl lessens. &lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Charl 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Cholen, you know that you are heard. Sudden heady joy courses through you, lifting your heart and strengthening your spirit, and your mouth fills with the taste of exquisitely fine wine. You feel yourself grinning in spite of yourself.&lt;br /&gt;
::The sound of laughter and music dances through the air, and, from the corner of your eye, you glimpse the forms of bright-garbed harlequins turning somersaults and tossing juggling balls back and forth -- but it is impossible to catch even one jester with a straight-on glance, for the celebratory spirits fade into memory as soon as you spy them. The power of Cholen has answered your prayer.&lt;br /&gt;
::A throwing knife formed of shimmering golden light hurtles from the hand of one of the spirit jesters toward TARGET.&lt;br /&gt;
::Your connection to Cholen lessens. The airy, brisk trill of a well-played fife and a quick cymbal crash heralds the departure of the spirit jesters.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::A sudden smile crosses CASTER&#039;s face and broadens into an infectious, easy grin.&lt;br /&gt;
::The sound of laughter and music dances through the air, and something brightly colored flickers at the edges of your vision.&lt;br /&gt;
::You glimpse movement at the corner of your eye right before a throwing knife formed of golden light hurtles toward TARGET.&lt;br /&gt;
::The trill of the fife and the crash of cymbals echo through the air from no apparent source, and then the peculiar, colorful flickering at the edges of your vision goes away. &lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Cholen 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Eonak, you know that you are heard. You feel heat against your face like the heat of a forge close at hand as a faint ruddy haze swirls into existence.&lt;br /&gt;
::The reddish haze shifts and solidifies into the image of a short, stocky, copper-skinned man bending over an anvil. He pays no attention to you or to anything around you, but you know that the power of Eonak has answered your prayer.&lt;br /&gt;
::Within the reddish haze swirling beside TARGET, the man brings his forging-hammer sharply down upon the anvil, producing a loud clang.&lt;br /&gt;
::The ruddy haze near you dissipates, and the sound of the forging hammer dies away. As the forge-fire&#039;s heat leaves your skin, your connection to Eonak lessens.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
::&#039;&#039;(missing manifestation name)&#039;&#039;&lt;br /&gt;
::Gazing into the ruddy haze, you see the image of a short, stocky, copper-skinned man bending over an anvil. He pays no attention whatsoever to you as he wields his forging hammer, and the orange light reflecting from his forge fire obscures his features from view. &amp;lt;section end=Eonak 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Imaera, you know that you are heard. The deep, quiet anger of the wilderness awakens within you, and you smell forest loam and hear the sound of wind passing through tree branches.&lt;br /&gt;
::As the ground trembles, you know that the power of Imaera has answered your prayer, and you sense the forms of animal spirits running past unseen.&lt;br /&gt;
::A brown stag materializes in midair, leaping out of nowhere to try to impale TARGET upon its magnificent antlers!&lt;br /&gt;
::Almost even before the attack is complete, the stag leaps away as swiftly as it came and vanishes into the nothingness from which it sprang, allowing no time for retaliation.&lt;br /&gt;
::You sense the last of the spirit animals running away unseen, and the aroma of forest loam fades as your connection to Imaera lessens.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::The aroma of forest loam drifts softly past as CASTER bows her head reverently, accompanied by the sound of wind passing through tree branches.&lt;br /&gt;
::The ground trembles slightly, and you hear a rhythm like that of hooves striking the ground swiftly.&lt;br /&gt;
::A brown stag materializes in midair, leaping out of nowhere to try to impale TARGET upon its magnificent antlers!&lt;br /&gt;
::Almost even before the attack is complete, the stag leaps away as swiftly as it came and vanishes into the nothingness from which it sprang, allowing no time for retaliation.&lt;br /&gt;
::The earth falls still again, and the smell of forest loam fades away.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::Faint patterns of golden light and shadow glimmer on CLERIC&#039;s face, rather resembling the patterns cast by sunlight as it falls through leafy branches.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Imaera 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Jastev, you know that you are heard. A deep awareness of the ephemeral quality of the world fills you, and a man&#039;s low voice whispers into your ear, &amp;quot;This, like all things, shall pass.&amp;quot;&lt;br /&gt;
::Iridescent lights begin to swirl around you, each as brilliant as the finest paints an artist could buy -- malachite, lapis, ruby, saffron, umber, orchid, and a thousand other shades, as if you were wrapped in the center of a rainbow. The power of Jastev has answered your prayer.&lt;br /&gt;
::A beam of vermilion light lances away from the rainbow around you to strike TARGET, bathing the TARGET in colored radiance.&lt;br /&gt;
::A beam of cerulean light lances away from the rainbow around you to strike TARGET, bathing the TARGET in colored radiance.&lt;br /&gt;
::The iridescent lights surrounding you pop like soap bubbles, one by one, until the last one bursts in a small flare of starry radiance and is gone. Your connection to Jastev lessens.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Jastev 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::An aura of power, health, and vitality settles around CASTER.&lt;br /&gt;
::A brilliant silver glow encircles each of CASTER&#039;s hands and shapes a pair of ethereal silver-hued gauntlets.&lt;br /&gt;
::CASTER punches at TARGET. A massive bolt of silver light blazes away from his fist!&lt;br /&gt;
::CASTER looks briefly dejected as the ethereal silver gauntlets vanish from around his hands.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
::A faint, healthy flush tinges CASTER&#039;s cheeks, and an aura of power and vitality fills each of his movements. Silver light encircles each of his hands in ethereal silver gauntlets. &amp;lt;section end=Kai 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Koar, you know that you are heard. Heady power washes through your body as divine golden light encircles you.&lt;br /&gt;
::The ground shivers and trembles restlessly underfoot, and you sense incredible power and strength focusing upon your surroundings. The power of Koar has answered your prayer.&lt;br /&gt;
::The ground shakes powerfully directly underneath TARGET as a beam of golden light lances away from you to transfix TARGET.&lt;br /&gt;
::Your connection to Koar lessens, and the divine light fades around you. The ground shudders one last time before falling still.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::An aura of divine golden light blazes into existence around CASTER.&lt;br /&gt;
::The ground shakes powerfully directly underneath TARGET as a beam of golden light lances away from CASTER to transfix TARGET.&lt;br /&gt;
::&#039;&#039;&#039;(missing end messaging)&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Koar 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Lorminstra, the image of a snow-covered forest with an open ebon gate at its center flashes through your mind, and the cold of winter slowly settles into your bones.&lt;br /&gt;
::It begins to snow -- small, white, faintly glowing snowflakes that appear immediately overhead and drift delicately down to dissolve as soon as they strike the ground. Several strike your skin, and, instead of melting, they only deepen the icy chill that resides within your marrow. The power of Lorminstra has answered your prayer.&lt;br /&gt;
::As several faintly glowing snowflakes settle upon TARGET, they ignite with cold white flame.&lt;br /&gt;
::As your connection to Lorminstra lessens, the snowflakes stop falling, and the few that still cling to you melt away. The icy cold gradually lifts from your body.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Lorminstra 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Lumnis, you know that you are heard. As insight floods through you, the world around you seems misty and immaterial.&lt;br /&gt;
::As divine wisdom illuminates all things around you, you gain a greater understanding of the frail, tenuous nature of existence and the beauty within that fragility. The power of Lumnis has answered your prayer.&lt;br /&gt;
::Guided by the knowledge within you, you concentrate upon TARGET, and, by strength of will alone, you expose the natural weaknesses of TARGET.&lt;br /&gt;
::As your connection to Lumnis lessens, the world of divine insight slips away from you, destroying the subtle understanding that you so briefly managed to grasp.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER stares into the distance with an abstracted expression on her face.&lt;br /&gt;
::Tendrils of soft grey mist curl around CASTER&#039;s hands, and a matching pale grey light shimmers in her eyes.&lt;br /&gt;
::As CASTER stares at TARGET, the grey light in her eyes intensifies, and then tendrils of mist stretch from her hands to caress TARGET.&lt;br /&gt;
::The grey light dies from CASTER&#039;s eyes, and the tendrils of soft grey mist surrounding her hands dissipate.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Lumnis 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Oleani, you know that you are heard.  Comforting warmth fills you, and a woman&#039;s soft voice whispers into your ear, &amp;quot;What is the worth of that which threatens love?  I deem it to be nothing.  Let it pass from this world and be gone.&amp;quot;&lt;br /&gt;
::A faint pink tinge settles over all that you can see, and the scents of blooming wildflowers fill your senses as a light breeze stirs the air around you.  The power of Oleani has answered your prayer&lt;br /&gt;
::A shroud of pale pink light suddenly encircles a TARGET, and tiny tongues of pure white flame flicker at the heart of the shroud.&lt;br /&gt;
::The scent of wildflowers fades away, and the world returns to its natural hues.  Your connection to Oleani has lessened.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER chants a reverent litany and clasps her hands while tightly focusing her thoughts...&lt;br /&gt;
::A faint aura of pale pink light glimmers into existence around CASTER.&lt;br /&gt;
::A wisp of breeze stirs the air around CASTER, and the scent of blooming wildflowers suddenly fills your senses.&lt;br /&gt;
::The scents of blooming wildflowers fade from the air as the pink aura around CASTER dissipates.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
::A pale pink aura hangs around CASTER &amp;lt;section end=Oleani 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Phoen 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Ronan, you know that you are heard. Dreamlike lassitude fills your body, and everything darkens around you.&lt;br /&gt;
::Your vision splits and twins -- with one sight, you see the world around you, and, with the other, you see a wide, barren plain stretching away beneath a midnight sky. The silhouetted forms of pure black unicorns run soundlessly toward you across the dreaming plain. The power of Ronan has answered your prayer.&lt;br /&gt;
::Seen only by your spirit gaze, one of the dream unicorns lowers its head and charges fiercely toward TARGET! Just before impact, the unicorn&#039;s horn glows fiercely amber in hue.&lt;br /&gt;
::You lose sight of the dream unicorns and the barren plain upon which they run as your connection to Ronan lessens. The waking world seems brighter again as the sense of dreamlike lassitude leaves you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER gazes around sleepily, and a sourceless shadow falls over her, darkening CASTER and her possessions to the hues of the world beneath a starry midnight sky.&lt;br /&gt;
::CASTER&#039;s gaze unfocuses for a moment, and she blinks several times before her eyes refocus on the world around her.&lt;br /&gt;
::As CASTER gazes dreamily on, TARGET suddenly reacts in terror and alarm to some unseen attack.&lt;br /&gt;
::The sourceless shadow lifts from around CASTER, and she seems more awake and alert now.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::A sourceless shadow rests upon CASTER, casting her features and possessions into the hues that they would be beneath a starry midnight sky.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Ronan 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Tonis, a great wind sweeps into the area, causing everything in the vicinity to blow about wildly.&lt;br /&gt;
::As the wind continues to whip about, the world seems to slow down around you, and you are aware of a spiritual presence nearby, although you cannot manage to catch more than a fleeting golden blur in your vision. The power of Tonis has answered your prayer.&lt;br /&gt;
::Accompanied by a particularly impressive gust of wind, a fleeting golden blur flashes past TARGET.&lt;br /&gt;
::You glimpse the golden blur one last time, but then you lose track of it entirely as your connection to Tonis lessens. The wind&#039;s force lessens as well, and then the air falls still. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Tonis 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::Caster&#039;s gaze grows keen and feral as a golden haze streaked with black manifests around him.&lt;br /&gt;
::Suddenly, the shadows come alive with lithe feline forms, which prowl and stalk around in a wide-ranging circle.&lt;br /&gt;
::An ethereal (random feline) lunges toward TARGET, slashing out viciously with its claws!&lt;br /&gt;
::&#039;&#039;&#039;(missing end message)&#039;&#039;&#039;&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
::&#039;&#039;a shadowy group of lithe feline forms prowling in a wide ring about the area&#039;&#039;&lt;br /&gt;
::The glint of a claw, the gleam of a yellow eye, the graceful arch of a proud head, the disdainful flick of a tail in the second before a lightning-swift leap -- it is all that you can perceive of the circling forms. As soon as you try to focus your attention upon any single one of the shadows, it is gone, and an intense feeling of being watched creeps over you. &amp;lt;section end=Andelas 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Eorgina, you know that you are heard. Your own will shrivels like a dry autumn leaf in a firestorm as the dark Arkati&#039;s power sweeps through you.&lt;br /&gt;
::Midnight black flames, sparkling and shimmering like the darkest diamonds ever mined, rise from the ground in a wide circle around you. You feel the deadly heat, but your skin remains dry beneath it.&lt;br /&gt;
::Shimmering black flames lash out toward TARGET, encircling the TARGET in their deadly grasp.&lt;br /&gt;
::Your connection to Eorgina lessens, and the black flames instantly vanish, leaving you stranded and bereft of the presence of the Arkati&#039;s power.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER&#039;s lips twist in a cruel sneer as she straightens her back and glances around arrogantly. All light seems to dim, and the shadows cluster most densely around CASTER.&lt;br /&gt;
::Midnight black flames, sparkling and shimmering like the darkest diamonds ever mined, rise from the ground in a wide circle around CASTER. The fire is searingly hot, but CASTER seems oblivious to the heat.&lt;br /&gt;
::Shimmering black flames lash out toward TARGET, encircling the TARGET in their deadly grasp.&lt;br /&gt;
::Abruptly, the black flames around CASTER wink out, leaving not even a wisp of smoke behind.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
:: &amp;lt;section end=Eorgina 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Ivas 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Luukos, you know that you are heard. Your skin prickles slightly all over your body, and a deep, resonant hiss echoes through your skull.&lt;br /&gt;
::An agonized, bitter moan echoes through the area from an unseen source, and a dark emerald radiance ripples through the air around you. The power of Luukos has answered your prayer.&lt;br /&gt;
::Long, spectral talons materialize from midair to tear viciously at the body of TARGET!&lt;br /&gt;
::A spectral howl echoes through the air, resonant with pain and anguish. Your skin prickles again as your connection to Luukos lessens.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Luukos 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Marlu, you know that you are heard. Everything wavers slightly, and your forehead stings as if it were touched by a drop of some caustic liquid, but the pain lasts less than a second.&lt;br /&gt;
::Tendrils of seeping black mist materialize at a safe distance away from you. A great awareness of their incredibly lethal power presses into your mind as the tendrils begin to shift and coil about in search of prey. The power of Marlu has answered your prayer.&lt;br /&gt;
::A tendril of black mist suddenly senses the proximity of TARGET. The mist expands into a large, quickly moving, highly lethal cloud that rapidly surrounds TARGET, obliterating it from view.&lt;br /&gt;
::The tendrils of black mist dissolve back into nothingness as your connection to Marlu lessens.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Marlu 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Mularos, you know that you are heard. The sting of an unseen triple lash blazes across your face, and, as blood drips slowly down your cheek, you feel the touch of an invisible hand resting lightly against your throat.&lt;br /&gt;
::The touch of the ethereal hand against your throat grows colder, and the sensation shifts to encircle your neck like a collar. Before this manifestation of divine will, you are helpless, and you are helpless as well as the very air around you solidifies into a barbed whip, coiling and shifting restlessly. The power of Mularos has answered your prayer.&lt;br /&gt;
::The ethereal barbed whip that lies loosely coiled around you uncoils at terrifying speed. It snaps out toward TARGET!&lt;br /&gt;
::As your connection to Mularos lessens, the cold, invisible collar locked about your throat fades into a compassionate caress, and a similar caress traces its way across the side of your cheek. Beneath that gentle touch, the wounds upon your face heal immediately. The ethereal barbed whip twitches one last time before dissolving back into air.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::Three long, raw scarlet lash-marks suddenly appear upon CASTER&#039;s face from no visible source.&lt;br /&gt;
::The very air around CASTER solidifies into a barbed whip, which coils and shifts restlessly.  The handle moves independently of any wielder.  CASTER stands frozen as drops of blood course slowly down her cheek.&lt;br /&gt;
::The ethereal barbed whip that lies loosely coiled around CASTER uncoils at terrifying speed.  It snaps out toward a TARGET!&lt;br /&gt;
::The wounds on CASTER&#039;s face heal, and the ethereal barbed whip coiled around CASTER twitches one last time before dissolving into air.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::Blood drips slowly down CASTER&#039;s face from three long, raw lash marks etched parallel across her cheek.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
::an ethereal barbed whip that moves without a wielder &amp;lt;section end=Mularos 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Sheru, you know that you are heard. The world darkens around you, casting everything into a murky shadow.&lt;br /&gt;
::Visible only at the corner of your vision, you glimpse a pair of dark amber eyes watching from the shadows, and a low, deliberate growl seethes slowly through the air from no discernable source. The power of Sheru has answered you.&lt;br /&gt;
::TARGET looks distinctly nervous, shifting its weight and peering around.&lt;br /&gt;
::Suddenly, TARGET tries to bolt away, but instead smashes into a wall of spectral force hidden within the shadows!&lt;br /&gt;
::Your connection to Sheru lessens, and the murky shadows brought by your appeal fade away, yet the feeling of being watched does not. On any night, in any dream or nightmare, those amber eyes will follow you endlessly... but such is the prize and the price of your devotion.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::Darkness settles over the area, spreading outward from CASTER to cast everything into a murky shadow.&lt;br /&gt;
::A deep, low-pitched growl seethes slowly through the air, and you have the distinct feeling that something is watching you from the depths of the murky shadow.&lt;br /&gt;
::TARGET looks distinctly nervous, shifting its weight and peering around.&lt;br /&gt;
::Suddenly, TARGET tries to bolt away, but instead smashes into a wall of spectral force hidden within the shadows!&lt;br /&gt;
::The murky shadow slowly lifts from the area, and the feeling of being watched passes gradually away. &lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Sheru 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to V&#039;tull, you know that you are heard. A sudden wave of bloodlust rages through you, and the world drops away into the black haze of a berserker&#039;s frenzy.&lt;br /&gt;
::From within the dark well of bloodlust, you thrill with berserker&#039;s ecstasy as you feel the power of V&#039;tull respond to your prayer. The weapon you need to satisfy your bloodlust materializes before you -- a jet black scimitar that hangs in midair and responds to your pure will.&lt;br /&gt;
::Divine will surges through you, and you command the scimitar to strike at TARGET.&lt;br /&gt;
::Your connection to V&#039;tull lessens, causing the searing bloodlust to vanish instantly away from you. The scimitar is gone, the haze of berserking hunger has left you, and you feel drained and tired.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER lets out a hoarse, ragged cry of bloodlust, and black haze films his eyes.&lt;br /&gt;
::A jet black scimitar coalesces in front of CASTER, and he fixes his black-filmed eyes on it with the expression of a fanatic witnessing a divine miracle.&lt;br /&gt;
::As CASTER lets out a furious, hungry howl, the jet black scimitar hanging in the air beside him whirls through the air to strike at TARGET.&lt;br /&gt;
::The jet black scimitar beside CASTER vanishes, and he staggers slightly as the black haze vanishes from his eyes.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::A haze as black as night films CASTER&#039;s eyes.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
::&#039;&#039;a jet black scimitar hanging unsupported in midair&#039;&#039;&lt;br /&gt;
::Other than the fact the black scimitar is floating in midair, it appears to be a normal scimitar.&lt;br /&gt;
::&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER grasps the scimitar firmly by the hilt, but it jerks away from him of its own accord. &amp;lt;section end=V&amp;amp;#39;tull 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Gosaena, you know that you are heard. Everything around you seems to slow down as a deep, biting chill sinks through your skin and into your very heart.&lt;br /&gt;
::From the corner of your eye, you glimpse slight motion. Although you still can perceive sound, no sounds seem important when compared to the silence at the center of your being. The power of Gosaena has answered your prayer.&lt;br /&gt;
::An ethereal pair of feathered white wings materializes from midair and closes around TARGET.&lt;br /&gt;
::You realize that you had ceased to hear the sound of your own heartbeat only when you become aware of it again, and other sounds filter back into your awareness as well. Warmth returns to your body as your connection to Gosaena lessens.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER&#039;s expression grows calm and chill, and ice blue radiance flickers in the depths of his eyes.&lt;br /&gt;
::The ambient air temperature plummets, and every sound seems slightly muffled as the cold bites into your skin.&lt;br /&gt;
::An ethereal pair of feathered white wings materializes from midair and closes around TARGET.&lt;br /&gt;
::The ice blue radiance flickers one last time in CASTER&#039;s eyes before vanishing like a candle flame. Warmth returns to the air, and the sounds you hear no longer seem muffled.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::Ice blue radiance flickers in the depths of CASTER&#039;s eyes, and his expression is like fine porcelain in its intense calm.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Gosaena 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Zelia, you know that you are heard. Something inside your head snaps, and with unnatural clarity you see three crescent moons gleen to life just above your head. You sense great wisdom waiting to be unlocked.&lt;br /&gt;
::Chaotic visions and marvelous images flicker around you as the outside world slips farther and farther away from your awareness. What does it matter, anyway, when you are so close to [&#039;&#039;the great wisdom is randomized... examples: creating the proper interpretation of chocolate; abdicating the post of moldy cheese&#039;&#039;]. The power of Zelia has answered your prayer.&lt;br /&gt;
::&#039;&#039;Randomized attack messaging... examples:&#039;&#039;&lt;br /&gt;
::You notice TARGET nearby. How marvelous! You command the moon Liabo to tattoo blue lines on your ankle.&lt;br /&gt;
::You notice TARGET nearby. How marvelous! You command some lilies of the valley to set it on fire.&lt;br /&gt;
::You notice TARGET nearby. How marvelous! You command the bartender to keep it in the aviary.&lt;br /&gt;
::You notice TARGET nearby. How marvelous! You command seventeen will&#039;o&#039;the&#039;wisps to mop the floor.&lt;br /&gt;
::Suddenly, the important insights slip away, leaving you drained and exhausted as you plummet back to a more mundane state of mind. Your throat and sides are slightly sore, and your cheeks are wet with tears. Your connection to Zelia has lessened.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER&#039;s face suddenly grows transfixed with an expression of awe and wonder, and sourceless silvery light plays in his eyes.&lt;br /&gt;
::CASTER giggles oddly.&lt;br /&gt;
::CASTER stares at a zombie for a moment before bursting into a fit of hysterical laughter. As tears stream down his cheeks with the force of his mirth, colorful light shimmers for an instant around the zombie.&lt;br /&gt;
::CASTER abruptly stops laughing and looks around with a dazed expression.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::Sourceless silvery light shines in CASTER&#039;s eyes, and his expression is contorted with manic glee.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Zelia 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Aeia, you know that you are heard. You smell the exotic scents of jungle flowers and feel a comforting presence nearby.&lt;br /&gt;
::As the scent of blossoming lilies fills your senses, a light green glow forms around you and coalesces into living jungle vines that twine over your shoulders and down your arms. They rest as lightly as a second skin, feeling almost like another part of your body. The power of Aeia has answered your prayer.&lt;br /&gt;
::You sense a surge of vital growth among the vines that cloak your shoulders. Suddenly, a long, leafy vine shoots out and tries to wrap around a hill troll.&lt;br /&gt;
::As your connection to Aeia lessens, the jungle vines dissolve back into light green radiance, and the radiance seeps softly into your skin.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Aeia 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Amasalen 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Arachne 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::CLERIC&#039;s eyes are haloed with a strange protrusion of barnacles that appear to have sprouted from his skin.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Ghezresh 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to the Huntress, you feel briefly sick and dizzy as you sense a flow of venom pulsing through your arteries and veins. The sickness and venom vanish entirely after only a second, and you feel more awake and alert.&lt;br /&gt;
::Silvery light briefly glimmers over everything that surrounds you, and a wave of carefully controlled anger that is not your own emotion tunes your pulse to a low, steady thrumming. You are little more than a channel for the source of the emotion that stares around through your eyes. The power of the Huntress has answered your prayer.&lt;br /&gt;
::A silver-bladed scythe materializes from thin air, spinning end over end as it hurtles toward TARGET!&lt;br /&gt;
::As your connection to the Huntress lessens, the foreign anger that lent you strength passes from your body as well, and your heartbeat returns to its regular pace.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=The Huntress 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Jaston 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Kuon, you know that you are heard. The smells of herbs and flowers fill your senses, invigorating and uplifting you even as a deep calm settles over you.&lt;br /&gt;
::The light scents of wildflowers grow stronger as insubstantial brown vines, thick and broad, coil out of the ground around you. Many of the vines sport large, colorful blossoms.&lt;br /&gt;
::One of the vines suddenly whips about and lashes out at TARGET! Despite its slightly ethereal appearance, the vine moves with every evidence of heavy, solid weight.&lt;br /&gt;
::As the spiritual peace slowly leaves you, the vines shimmer and vanish one by one, and the scent of wildflowers drifts away as your connection to Kuon lessens.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Kuon 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
:As you pour your soul into an appeal to Laethe, you know that you are heard. You feel a brief, cool pressure on your brow, like a kiss of benediction.&lt;br /&gt;
:Ethereal shadowy black roses sprout from the ground in a wide ring around you, twisting and twining about as they grow. The power of Laethe has answered your prayer.&lt;br /&gt;
:A shadowy black rose touches TARGET and wraps immediately about it, struggling to force its long, barbed thorns into the TARGET.&lt;br /&gt;
:You feel the kiss of benediction once more upon your brow, and then your connection to Laethe lessens. The shadowy black roses dissolve into tendrils of black, rose-scented smoke that dissipate rapidly.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::The image of a stylized black rose appears on CASTER&#039;s forehead, surrounded by a faint violet glow.&lt;br /&gt;
::A shadowy black rose touches a TARGET and wraps immediately about it, struggling to force its long, barbed thorns into it.&lt;br /&gt;
::The shadowy black roses dissolve into tendrils of black, rose-scented smoke that dissipate rapidly.  The black rose mark vanishes from CASTER&#039;s forehead.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039; &lt;br /&gt;
::A faint violet glow surrounds a stylized black rose mark glimmering on CASTER&#039;s forehead.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
::&#039;&#039;a ring of ethereal black roses&#039;&#039;&lt;br /&gt;
::&#039;&#039;(Looking at a ring of ethereal black roses)&#039;&#039; Wickedly sharp thorns glimmer among the shadowy petals and tangled vines.&lt;br /&gt;
::&#039;&#039;(Touching a ring of ethereal black roses)&#039;&#039; &lt;br /&gt;
:::&#039;&#039;&#039;{{Smallcaps|[1p - Caster]}}&#039;&#039;&#039; The thorns avoid your flesh as you reach past the brambles, and your fingertips caress the silky softness of a rose petal.&lt;br /&gt;
:::&#039;&#039;&#039;{{Smallcaps|[1p - Other]}}&#039;&#039;&#039; Those thorns look very sharp!  That probably isn&#039;t a good idea.&lt;br /&gt;
:::&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER caresses one of the shadowy black roses growing in a ring around her.&lt;br /&gt;
::The shadowy black roses dissolve into tendrils of black, rose-scented smoke that dissipate rapidly.  The black rose mark vanishes from CASTER&#039;s forehead.&lt;br /&gt;
:: &amp;lt;section end=Laethe 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Leya, you know that you are heard. A wave of divine sorrow and anger washes through you, and, on the trailing end of that wave, and a rush of controlled power flows from your heart to your fingertips and toes.&lt;br /&gt;
::An ivory light blossoms into existence around you.&lt;br /&gt;
::A dagger of ivory light suddenly flashes away from the aura surrounding you to strike at TARGET.&lt;br /&gt;
::The ivory light around you fades and glimmers out, and the strength and control of your movements lessens along with your connection to Leya.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER&#039;s posture falls into a graceful fighting stance, and her movements are more controlled and executed with greater purpose.&lt;br /&gt;
::An ivory light blossoms into existence around CASTER.&lt;br /&gt;
::A dagger made of ivory light suddenly flashes away from CASTER to strike at TARGET.&lt;br /&gt;
::The ivory light fades from around CASTER, and her movements are somewhat slower and less controlled.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Leya 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Niima, you smell the fresh scent of a sea breeze, and you hear the cries of fenvaok overhead.&lt;br /&gt;
::A shimmer in the air precedes the materialization of a pillar of swirling, blue-green water as tall as a giantman not far away from you. From somewhere in the center of the pillar comes a haunting, wordless threnody. The power of Niima has answered your prayer.&lt;br /&gt;
::As the song from the pillar of water crescendos, it reaches a pitch that normally only trained bards can achieve, and the intense waves of elegant sound focus upon TARGET.&lt;br /&gt;
::The singing from the watery pillar begins to fade as your connection to Niima lessens. The pillar thins, then suddenly drops with a great splash! You are utterly drenched in water.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::A fresh, sea-scented breeze washes past, and the cries of fenvaok sound overhead.&lt;br /&gt;
::A shimmer in the air precedes the materialization of a pillar of swirling, blue-green water as tall as a giantman beside CASTER. From somewhere in the center of the pillar comes a haunting, wordless song.&lt;br /&gt;
::As the song from the pillar of water beside CASTER crescendos, it reaches a pitch that normally only trained bards can achieve, and the intense waves of elegant sound focus upon TARGET.&lt;br /&gt;
::The singing from the watery pillar beside CASTER fades into silence. The pillar stands for a moment longer before dropping to the ground with a great splash! CASTER is totally drenched, but you manage to avoid anything more than a few stray drops.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
::&#039;&#039;a swirling blue-green pillar of water&#039;&#039;&lt;br /&gt;
::The pillar stands as tall as a full-grown giantman. It is not possible to see through it, despite its translucent nature, for gazing into the pillar reveals the same cool, blue-green depths that stretch down through the fathoms of a sunlit sea. Shimmering, sleek forms chase one another through the swirling currents at its center, but it is impossible to spy any of them long enough to determine its precise nature.&lt;br /&gt;
::&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; The swirling currents yield readily to your hand, and you reach into the pillar of water. One of the shimmering forms darting through the pillar&#039;s blue-green depths draws curiously near, and you briefly glimpse the curious silver eyes of the water spirit in the instant before it loses interest and returns to its play.&lt;br /&gt;
::&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER touches the blue-green pillar of water, and his hand sinks easily into its surface. There is a flash of silver within the pillar near him. &amp;lt;section end=Niima 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Onar, you know that you are heard. In the depths of your soul, you make the contract that will permit you a chance to obtain the death that you desire.&lt;br /&gt;
::You sense the power of Onar near at hand.&lt;br /&gt;
::A bone-shafted crossbow bolt flies out of the shadows toward TARGET!&lt;br /&gt;
::As it reaches the end of its flight, the bone-shafted crossbow bolt disintegrates into unrecognizable dust.&lt;br /&gt;
::&#039;&#039;&#039;(missing end message)&#039;&#039;&#039;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Onar 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Tilamaire, you know that you are heard.  Every sound grows more distinct and acute, and, at the very edges of your awareness, you sense a greater harmony echoing softly through everything around you.&lt;br /&gt;
::You begin to hum very softly, harmonizing your notes with those of the greater harmony in the background.&lt;br /&gt;
::Listening carefully to the quiet harmony around you, you give voice to wordless song, and the notes of your song ring discordantly against the sounds of the world that relate to a TARGET.&lt;br /&gt;
::As your connection to Tilamaire lessens, you lose track of the greater harmony within all things, and, regretfully, you bring your song to a close.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER tilts her head slightly, as if listening to something, and her face lights with a warm smile.&lt;br /&gt;
::CASTER begins to hum softly, a sweet, soft melody that somehow manages to harmonize with every random noise and tiny sound of your surroundings.&lt;br /&gt;
::CASTER sings a wordless, beautiful melody at a TARGET.&lt;br /&gt;
::CASTER seems to be straining to hear a fading melody.she shakes her head slightly and brings her soft humming to an end.&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Tilamaire 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::As you pour your soul into an appeal to Voaris, you know that you are heard. You feel a brief, warm pressure on your brow, like a kiss of benediction.&lt;br /&gt;
::Luminescent golden roses sprout from the ground in a wide ring around you, twisting and twining about as they grow. The power of Voaris has answered your prayer.&lt;br /&gt;
::A glowing golden rose touches TARGET and bursts into scarlet flame!&lt;br /&gt;
::You feel the kiss of benediction once more upon your brow, and then your connection to Voaris lessens. One of the glowing golden roses lights with scarlet flame, and the fire spreads rapidly down the vine until every rose is burning. The flames consume the roses swiftly and without smoke, until, in less than a second, the roses are gone entirely.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::The image of a stylized scarlet rose appears on CASTER&#039;s forehead, glowing softly.&lt;br /&gt;
::Luminescent golden roses sprout from the ground in a wide ring around CASTER, twisting and twining about as they grow.&lt;br /&gt;
::A glowing golden rose touches TARGET and bursts into scarlet flame!&lt;br /&gt;
::One of the glowing golden roses lights with scarlet flame, and the fire spreads with astonishing speed down the vine until every rose is burning. The flames consume the roses swiftly and without smoke, until, in less than a second, the roses are gone entirely. The scarlet rose mark vanishes from CASTER&#039;s forehead.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::A stylized scarlet rose mark glows softly on her forehead.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039;&lt;br /&gt;
::&#039;&#039;(missing manifestation name)&#039;&#039;&lt;br /&gt;
::Not even one thorn adorns the thick stalks of the gracefully coiling roses. The wide-petalled blossoms are sunlight yellow in hue, and a soft radiance encircles each one.&lt;br /&gt;
::&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Warmth flows up your hand as your fingertips caress the silky softness of a rose petal. &amp;lt;section end=Voaris 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Voln 335 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
===Unaligned===&lt;br /&gt;
;Other &amp;lt;section begin=Other 335 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{smallcaps|[Look Caster]}}&#039;&#039;&#039;&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Manifestation]}}&#039;&#039;&#039; &lt;br /&gt;
:: &amp;lt;section end=Other 335 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Symbol of the Proselyte (340)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your Charl symbol. A roiling wave of light crashes over your hand, and the symbol, bathing both in a wash of blue and green.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your emerald trident talisman. A rush of divine power washes over you. Your talisman pulses once and you feel the power of Charl gathering within you like a storm. &amp;lt;section end=Charl 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Cholen 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Eonak 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your amber doe talisman.  A glow grows, slowly but surely, and both your hand and the talisman are bathed in a fresh green light, the color of unfurling leaves.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your amber doe talisman.  A rush of divine power washes over you.  Your talisman pulses once and you feel the generative power of Imaera growing within you. &amp;lt;section end=Imaera 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Jastev 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Kai 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your crown symbol. A rush of divine power washes over you. Your symbol pulses once and you feel the might of Koar overtake you. &amp;lt;section end=Koar 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your banded onyx key symbol. The edges of your hand go black, and from the core of the symbol shines a golden light. The effect is not unlike light through a keyhole.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your banded onyx key symbol. A rush of divine power washes over you. Your symbol pulses once and you feel the eternal watchfulness of Lorminstra staring through your eyes. &amp;lt;section end=Lorminstra 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Lumnis 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your ruby heart symbol.  Within the symbol, a roseate light blooms, growing to cover your entire hand.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your ruby heart symbol.  A rush of divine power washes over you.  Your symbol pulses once and you feel the warmth of Oleani&#039;s love within you. &amp;lt;section end=Oleani 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen  &amp;lt;section begin=Phoen 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Phoen 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your ebony symbol of Ronan. A shadow falls over your hand, and the symbol of Ronan, though a few pinpricks of starry brightness shine through.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your obsidian sword symbol. A rush of divine power washes over you. Your symbol pulses once and you feel the sleeping might of Ronan awake within you. &amp;lt;section end=Ronan 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Tonis 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Andelas 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your HOLY SYMBOL.  Heatless flames, crackling crimson and gold and orange, writhe between your fingers and across the surface of the HOLY SYMBOL.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your silver vaalin censer. A rush of divine power washes over you. Your censer pulses once and you feel the majesty of Eorgina driving you, like a wall of flames licking at your back. &amp;lt;section end=Eorgina 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Ivas 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Luukos 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your {item}.  Both suddenly go black and your fingers clench into a painful claw, the edges of the talisman pressing hard into your flesh.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Marlu 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your Mularos symbol.  Spears of steely silver light pierce your palm, penetrating the surface of the symbol.  A faint crimson glow lingers.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your Mularos symbol.  A rush of divine power washes over you.  Your symbol pulses once and you feel Mularos within you, his presence and the suffering of the world condensed into your heart.  &#039;&#039;&#039;Later&#039;&#039;&#039; The divine power suffusing your actions wanes, leaving you bereft of Mularos&#039; aid.&amp;lt;section end=Mularos 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Sheru 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=V&amp;amp;#39;tull 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Gosaena 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Zelia 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia  &amp;lt;section begin=Aeia 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Aeia 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Amasalen 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your holy symbol. A rush of divine power washes over you. Your symbol pulses once and you feel the comforting presence of Kuon within you, like a healing balm. &amp;lt;section end=Kuon 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Arachne 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Ghezresh 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=The Huntress 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Jaston 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Kuon 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your dreamstone rose symbol.  The symbol blooms suddenly and swiftly with a heavily thorned black ethereal rose.  The petals of the blossom are quickly shed, however, each one falling away in a burst of purple sparks.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your dreamstone rose symbol.  A rush of divine power washes over you.  Your symbol pulses once and you feel Laethe&#039;s sense of loss like a blow.&lt;br /&gt;
&amp;lt;section end=Laethe 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Leya 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Niima 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your white skull symbol.  A flash of light illuminates all of the bones beneath your flesh and every edge of the symbol.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your white skull symbol.  A rush of divine power washes over you.  Your symbol pulses once and you feel the cold, calculated drive of Onar guiding you. &amp;lt;section end=Onar 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your note symbol.  A golden glow winds its way out of the center of the symbol, each mote of light a distinct and shining note in the air.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your note symbol.  A rush of divine power washes over you.  Your symbol pulses once and you feel the song within your heart quicken with the presence of Tilamaire.&amp;lt;section end=Tilamaire 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; You rest your hand atop your Voaris symbol.  The symbol blooms suddenly and swiftly with a velvety yellow ethereal rose.  The petals of the blossom spread, then fall away slowly, each one dissolving into golden sparks.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; You chant a reverent orison and lightly clasp your Voaris symbol.  A rush of divine power washes over you.  Your symbol pulses once and you feel Voaris within you, daring you to act.&amp;lt;section end=Voaris 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Voln 340 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 340 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Chant]}}&#039;&#039;&#039; &amp;lt;section end=Other 340 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Miracle (350)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As the air stirs, you feel your spirit drawn to the heavy scent of the ocean and feel a deep sense of peace. Clouds move into the area, their murky depths heavy with rain unshed and you can see lightning dancing within them. The pressure builds all around you until suddenly, the heavens release dozens of slender blue bands of lightning. The lightning fills your body with its energy and the very air around you seems to tingle with it. Moments later, the lightning is gone and the clouds soon follow.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Laden with the scent of the ocean, a wind moves through the area drawing with it dark clouds heavy with rain. Lightning dances in the murky depths, outlining the edges of the cloud with its blue glow. Suddenly, lightning strikes the ground around the prone form of CLERIC and dances across his skin. Seconds pass while you remain under the glow of the electrical ballet playing out upon CLERIC, and then slowly the clouds disappear, taking the lightning with them. &amp;lt;section end=Charl 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Cholen 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Odd whirls and metallic clangs herald the arrival of a dwarf crafted entirely of bronze. The strange, mechanical man moves with jerky movements to a position beside the prone form of CLERIC and begins to tinker with his appearance and clothing. At first, nothing seems to come of the strange bronze creature&#039;s meddling, but slowly color returns to CLERIC&#039;s face. Steam billowing from its ears, the metallic dwarf straightens and teeters from the area, dissipating as it moves. &amp;lt;section end=Eonak 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Time stills around you, and you feel your spirit drawn forward by a pale ethereal light which quickly transforms into a translucent woman. She moves to your side and withdraws two crimson oak leaves and an acorn from her basket. You hear her soft prayer as she places the leaves upon your eyes and presses the acorn past your lips. She turns her eyes to the sky, her arms rising in supplication, and then lays her hands briefly on your chest. Instantly, warmth floods your limbs and the woman returns to the pale light.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Imaera 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Jastev 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Large and ethereal, rectangular talismans rise from the ground to form a ring around your lifeless form. Each talisman is carved with a different word and glows with a brilliant light. One by one, the talismans tumble into you. As the first falls upon you, you are filled with a deep sense of Honor, the second reminds you of Valor in battle, and the third causes your spirit to surge with Hope, while the fourth binds you with the strength of your Faith. The remaining two tumble into you simultaneously and, in a flash of white light, you absorb them all. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  {{addmetext}} &amp;lt;section end=Kai 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Creating a myriad of colorful whorls in the air, a flock of small rainbow-winged lizards swirls towards you and you are filled with a deep connection to them. Diving and darting, they cavort above your corpse in an intricate dance that is breathtaking to behold. As they dance, their wings shimmer and shed multi-colored sparks that rain down upon your body. With each spark that alights upon your flesh, you are filled with a tingling sensation that draws your spirit deep into your body. The aerial display ends in one final loop and the rainbow-winged lizards dart off into the distance, only to wink out of sight a moment later.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  {{addmetext}} &amp;lt;section end=Koar 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Distant and echoing, the sound of keys jingling strikes a familiar chord within you as it precedes the sound of a heavy metal gate slamming shut. Pale snowflakes drift through the air and settle upon your lifeless body. As the snow accumulates into a thin, chilling layer, you distinctly hear the somber voice of a female speaking softly in your ear. &amp;quot;The gates are closed to you for now, my child,&amp;quot; she says, and several moments later the snow seeps into your skin, leaving you chilled and damp.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Distant and echoing, the sound of keys jingling precedes the sound of a heavy metal gate slamming shut. Pale snowflakes drift through the air and settle upon the lifeless body of CLERIC. The light dusting covers her form, obscuring it from sight for several moments before the flakes melt away leaving CLERIC&#039;s clothing damp. &amp;lt;section end=Lorminstra 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;Squawking loudly, a quintet of parrots wings into the area and circles over your lifeless form.  Each bird is banded with feathers in hues of white, black, red, blue, and green, which begin to blur as the parrots fly overhead.  As they swirl into a tight circle, a feeling of understanding and compassion sweeps over you, and the birds, now suddenly insubstantial, drive into your chest.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;Squawking loudly, a quintet of parrots wings into the area and circles over the prone form of Daenalan.  Each bird is banded with feathers in the hues of white, black, red, blue, and green, which begin to blur as the parrots fly overhead.  Swirling into tight circles, the birds, now suddenly insubstantial, dive into Daenalan&#039;s chest. &amp;lt;section end=Lumnis 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;A warm spring breeze teases along your lifeless body, plucking at your clothes.  Distant pressure builds in your heart and then spills forth, suffusing you with the warmth of love even as a tiny tendril of palest green pushes into view high on your chest.  Petals swell from its tip, bursting broadly forth in velvety scarlet, scarce before a bud can form.  The reflection of golden sunlight glimmers at the heart of the sudden blossom for a scant moment before the petals spread and fall, leaving faint trails of pinkish light in their wake as they shimmer out of view.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;A warm spring breeze teases along Subarashi&#039;s lifeless body, plucking at her clothes.  Ever so slowly, a tiny tendril of palest green pushes into view high on her chest.  Petals swell from its tip, bursting broadly forth in velvety scarlet, scarce before a bud can form.  The reflection of golden sunlight glimmers at the heart of the sudden blossom for a scant moment before the petals spread and fall, leaving faint trails of pinkish light in their wake as they shimmer out of view. &amp;lt;section end=Oleani 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Regal and proud, a broad-shouldered ethereal lion strides towards your lifeless form and you are filled with a sense of power and glory. As it moves towards you, its mane begins to shimmer with licking flames that resemble the rays of the sun. It lowers its gaze to you and you feel yourself drawn into their amber depths. The golden beast lifts a paw to your chest and a wave of warmth floods your limbs. As the light grows, the lion begins to dissipate into a golden nimbus that sinks into your body.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  {{addmetext}} &amp;lt;section end=Phoen 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; The sounds of night drift to your ears and you feel a deep lassitude flood your spirit. At the edge of your vision the pale white beautiful image of a unicorn begins to take shape. It paws at the air, its silver hooves creating sparks of light that twinkle like a thousand stars. As it lowers the horn to touch your forehead you feel a deep sense of peace that intensifies as a silver nimbus blankets you. The unicorn and the nimbus disappear at once, and you feel yourself waking slowly from a dream.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  {{addmetext}} &amp;lt;section end=Ronan 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Tonis 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Andelas 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Crisp and commanding, the air around you takes on a bitter cold that cuts sharply at your spirit.  Ruby red flames laced with silver suddenly appear upon your prone form and burn with a cold energy that does not scorch nor sear.  The wind stirs into a vortex that steals the light of the flames, and you hear a sharp command demanding that you rise.  Suddenly, the wind is gone.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Crisp and commanding, the air takes on a cold, sharp edge to it that chills deep to the bone.  Ruby red flames laced with silver suddenly appear upon the body of CLERIC and burn with a cold energy that does not scorch nor sear.  The wind stirs into a vortex that blinds the senses and steals the light of the flames, while a sharp, wordless command is uttered from high above.  Suddenly, the wind is gone. &amp;lt;section end=Eorgina 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Spidery and incomprehensible words reach you, and are given life by an aged, bodiless voice that carries with it the scent of dusty tomes and candle tallow. A point of dark light appears high over your body and expands to form a yellowed eye with a slit pupil. With each uttered syllable the eye&#039;s iris contracts and the meaning of the words that wrap you become clear. &amp;quot;You still have much more to learn,&amp;quot; they say, and before you the eye explodes in a blinding, fiery light.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Shimmering light tugs at your soul from somewhere above your head and you feel your spirit begin to tear.  You split into six parts, each patterned with a wisp of smoke that transforms into a female dancer.  Together, your spirit and the dancers twine their bodies in a sinuous dance that tugs at your hips and brings your arms high above your head.  You feel the presence of your body beneath you and move with the dancer&#039;s cavorting forms towards your lifeless mouth.  You watch as they bend to kiss you, and then let them draw you into the deep, dark recesses of your lips.  Warmth begins to spread through you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Ivas 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Punctuating the sudden calm of the area, the sound of slithering is quickly followed by a long, sibilant hiss. Winding a sinuous pattern to your head, an impossibly large copper-head snake with emerald green eyes begins to hiss at you. &amp;quot;There are more liessss to sssspread, and deathssss to ssssteal,&amp;quot; it says, and then swiftly raises high into the air to gaze down at you. Faster than the blink of an eye, the serpent dives into your chest and disperses into a shimmering green mist that seeps into your skin.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Punctuating the sudden calm of the area is the sound of slithering quickly accompanied by a long, sibilant hiss. Moving in a sinuous pattern towards CLERIC, an impossibly large copper-head snake with emerald green eyes slithers to a position just above his head and begins to hiss inches from his ear. Moving swiftly, the serpent raises high into the air and dives its head into his chest, disappearing into a shimmering green mist that seeps into his skin. &amp;lt;section end=Luukos 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Dark clouds swirl across your prone form and the area is plunged into darkness. The hair on your body stands on end and a deep pressure builds around your spirit, threatening to consume it. Blue lightning lances through the air, heralding an ear-shattering ripple of thunder, and at the edge of your senses you feel the demonic horde surging forward to take you. Each sizzling bolt strikes your chest repeatedly for several moments and the horde closes in on you until every last one of them is absorbed by your spirit.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Dark clouds swirl before the prone form of CLERIC and the area is plunged into darkness. The thick scent of ozone rises on the air and causes hair to stand on end as a deep pressure builds. Blue lightning lances through the area, accompanied by a ear-shattering ripple of thunder, and in the shadows cast by its afterglow is the image of hundreds of demons lurching and struggling towards CLERIC. Lightning strikes CLERIC in the chest repeatedly, sizzling the air with every strike. As the lightning ceases, shadowy demons rise and dive deep into CLERIC&#039;s chest. &amp;lt;section end=Marlu 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Wraithlike mourners suddenly slip free of the shadows and form a tight ring around you. Silvery tears slip from their faces to splash ineffectively against your lifeless body, and the blood that stains their white garments trickles in a splash across your face. They kneel in a tight ring about you, obscuring your view of the world beyond, and you feel a deep connection to them. &amp;quot;There is yet more pain to release,&amp;quot; they seem to tell you before their lips part in a deafening keen of anguish that shatters their ethereal forms.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Wraithlike mourners suddenly slip free of the shadows around CLERIC, their cheeks stained with silvery tears. Their white garments are stained in a variety of places with the deep red-brown of blood. Forming a loose ring around CLERIC&#039;s corpse, they fall as one to their knees and obscure him. Together, they tilt their heads back and release a deafening keen that shatters their ethereal forms. &amp;lt;section end=Mularos 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Shadows lengthen and grow around you until their edges are sharp and twisted. Macabre and ungraceful, they slink with jerky movements toward you as their depths are briefly illuminated by countless yellowed eyes set into the faces of a thousand horrors. They snarl as they writhe across your prone form, their maws snapping ineffectively at your flesh. One by one, they twist and squirm into your slack jaw and fill you with bitter madness.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Shadows lengthen and grow around the body of CLERIC until their edges are sharp and twisted. Moving in a macabre dance of jerky, ungraceful movements, the shadows become briefly illuminated by countless yellowed eyes set into the faces of a thousand horrors. Snarling, the shadows move across CLERIC&#039;s prone form and begin to snap ineffectively at his lifeless flesh. One by one, the twisted nightmares writhe and squirm into CLERIC&#039;s slack jaw and disappear within him. &amp;lt;section end=Sheru 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=V&amp;amp;#39;tull 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Stealing all sound as it travels to you, a soft zephyr gently caresses your skin and you sense the frigid brush of final death near at hand. A tug on your spirit heralds the arrival of impossibly long feathers in shades of white, grey, and black, as they appear before you and coalesce into a beautiful insubstantial being. It lifts you up into its arms and you feel as if you have found home in its embrace.&amp;lt;br&amp;gt;Wings that you did not notice before unfurl to cocoon you for several moments before you feel the chill air depart and all at once the feathery figure is gone. A rain of feathers falls around you, each dissipating seconds before it touches the ground.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Stealing all sound as it travels, a soft zephyr gently sweeps through the area turning the air frigid. Impossibly large ethereal feathers in shades of white, grey, and black, drift in and are carried to the prone form of CLERIC. At once they converge into a beautiful insubstantial being. Kneeling beside CLERIC, it gently lifts him into its arms and cradles him there for several moments.&amp;lt;br&amp;gt;Lowering its feathery forehead to CLERIC, the being unfurls a pair of pale wings and creates a cocoon around him. Suddenly, sound returns, dispelling the ethereal being and creating a rain of feathers, each dissipating seconds before it touches the ground. &amp;lt;section end=Gosaena 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Silver motes of light cavort upon the air, their movements turning into a twisted dance that is punctuated by the sound of dozens of laughing voices. Deep in your spirit, you feel a binding connection to their mirth. Converging above you, the light transforms in a slender crescent moon that begins to whirl. At one moment, full, and then the next, a sliver, the faster the moon spins, the louder the laughter gets. Suddenly, the light ceases all movement and explodes into a brilliant shower of silver sparks accompanied by laughter for several moments.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Zelia 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Aeia 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin= Amasalen 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Silence descends upon the room and a double-headed serpent slithers to you. Each of its heads moves of its own accord, and slit-pupiled eyes take in everything as they wind a sinuous path up your prone form. As it reaches your chest, it lifts its heads up high and begins to sway from side to side in a hypnotic pattern. &amp;quot;You have learned the ssssacrifice issss everything, now we ssssacrifice oursssselves sssso that you may teach otherssss,&amp;quot; the one head says before striking the other head at the neck. In one swift, painless bite, the head is severed and the open neck falls upon you, its lifeblood draining into your mouth. Moments pass as the ferric taste of the serpent&#039;s sacrifice fills you, and then suddenly it disappears. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Amasalen350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Arachne 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Invading the sudden peace of the area, an indigo mist oozes from the ground and begins to encompass CLERIC&#039;s corpse in its cloying, damp clutches.  Anguillid shapes begin to take form upon his skin, their twisting and twining bodies mucousy and slimy.  Two rise from CLERIC&#039;s chest and form an intimidating shadow over him, their silvery grey eyes focused on him.  With an aquatic gurgle, they lunge toward CLERIC&#039;s face and disappear in his nostrils.&amp;lt;section end=Ghezresh 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Filling your spirit with a deep anger, a long discordant horn blast drowns your senses and sets your lifeless flesh to vibrating with its wild call. An enormous hunting hound bearing an angry look of focus bounds towards you. You feel its front paws forcibly slam into your chest and watch the beast disappear deep within you with the cry of a wild hunt falling from its parted lips. Slowly, the sound of the horn echoes into silence.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; The area comes to life with the defiant call of a long discordant horn blast. An enormous hunting hound bearing an angry look of focus bounds into the area and launches itself at CLERIC. Slamming forcibly into her chest, the beast disappears into her with a cry of a wild hunt. Slowly, the sound of the horn echoes into silence. &amp;lt;section end=The Huntress 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Jaston 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Kuon 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Laethe 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Your spirit feels a sudden stirring in the air above your lifeless body and moments later a brilliantly white owl appears out of nowhere. It spreads its wings and you hear the audible crack of the air as they expand, lifting the owl in a lazy spiral above you. The bird&#039;s unblinking gaze falls upon you and you feel a deep connection with it before it gives three mighty beats of its wings and surges high into the sky and disappears.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Leya 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A playful feeling sweeps over you as a fuzzy pair of otters fills your vision. Clutched in their teeth are midnight blue mussels, which they hold tightly in place as they comically bounce and leap around you. They playfully paw at your lifeless chest, begging with their furry faces, and you sense they want you to come and play. As if sensing you cannot, they curl their sleek, wet forms briefly around your head and nuzzle against your neck for several moments. Then, they carefully drop the mussels upon your chest. A brief, child-like joy fills you as the mussels sink into your lifeless body, and the otters turn as one to slide out of sight on their slippery bellies.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Niima 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Shadows slant across the ground as they slither toward you and a deep chill touches your spirit. As the shadows writhe in a thick mass of darkness over your body, you distinctly hear a quiet whisper in your ear, &amp;quot;This was not the death I had in mind for you.&amp;quot; A flash of light tears across your vision as it is consumed by the image of a cracked white skull.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; {{addmetext}} &amp;lt;section end=Onar 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Your spirit is tugged by the familiar sound of lutes and lyres joining into a lively chorus of your favorite traveling song.  You watch as an ethereal band of merry minstrels strides towards you.  Their movements are filled with song and laughter, and as they pass you they lightly caress your lifeless body.  Everywhere they touch suddenly feels vibrant and alive; the feeling lingers with you long after they disappear from sight.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Tilamaire 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Voaris 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Voln 350 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 350 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; You feel a tingling at the edges of your perception and the air comes alive with a feeling of raw power. You sense something greater than yourself tugging on your spirit. As the power grows in intensity, you feel it draw you closer to your lifeless body and you marvel as it ushers your spirit forward. An extremely bright nimbus floods you as your spirit sinks into your body, which begins to fill with life.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Tingling on every nerve, the air comes alive with a feeling of raw power. Prismatic lights play through the air and hover over the prone form of CLERIC. As the power grows in intensity, the energy begins to tug and move at her clothing and the air grows warm. An extremely bright nimbus forms around her and then slowly seeps into CLERIC&#039;s body. &amp;lt;section end=Other 350 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Beacon of Courage (1608)]] ==&lt;br /&gt;
&lt;br /&gt;
;Pantheon of Liabo&lt;br /&gt;
:Motes of lambent white-gold light appear and begin to swirl around you, coalescing into a radiant aura.&lt;br /&gt;
:TARGET appears enthralled by the motes of lambent white-gold light.&lt;br /&gt;
:The aura of lambent white-gold light motes surrounding you dissipates slowly, winking out of existence.&lt;br /&gt;
&lt;br /&gt;
;Pantheon of Lornon&lt;br /&gt;
:Wisps of lucent silvered ebon smoke appear and begin to twist around you, coalescing into an incandescent veil.&lt;br /&gt;
:TARGET appears enthralled by the haze of lucent silvered ebon smoke.&lt;br /&gt;
:The haze of lucent silvered ebon smoke surrounding you dissipates slowly, thinning until nonexistent.&lt;br /&gt;
&lt;br /&gt;
;Pantheon of Neutrality&lt;br /&gt;
:Fingers of fog-hued mist appear and begin to twirl around you, coalescing into a scintillant miasma.&lt;br /&gt;
:TARGET appears enthralled by the miasma of fog-hued mist.&lt;br /&gt;
:The miasma of fog-hued mist surrounding you dissipates slowly, waning until completely diminished.&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Guard the Meek (1613)]] ==&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Charl 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Cholen 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Eonak 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Imaera 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Jastev 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Kai 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Koar 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Lorminstra 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Lumnis 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Oleani 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Phoen 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As CASTER thrusts her WEAPON toward the heavens, a soft night black pulse of pure spiritual energy rises from its apex, washing over herself and those nearby. &amp;lt;section end=Ronan 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you thrust your clenched fist upward, a soft golden pulse of pure spiritual energy rises from its apex, washing over you and those nearby&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As &amp;lt;caster&amp;gt; thrusts a clenched fist upward, a soft golden pulse of pure spiritual energy rises from its apex, washing over &amp;lt;caster&amp;gt; and those nearby. &amp;lt;section end=Tonis 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Andelas 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Eorgina 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Ivas 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Luukos 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you thrust your clenched fist upward, a soft flat black pulse of pure spiritual energy rises from its apex, washing over you and those nearby.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Marlu 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Mularos 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Sheru 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=V&amp;amp;#39;tull 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Gosaena 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Zelia 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Aeia 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Amasalen 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Arachne 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghrezresh 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Ghrezresh 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=The Huntress 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Jaston 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you thrust your clenched fist upward, a soft gold pulse of pure spiritual energy rises from its apex, washing over you and those nearby.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As CASTER thrusts a clenched fist upward, a soft gold pulse of pure spiritual energy rises from its apex, washing over CASTER and those nearby. &amp;lt;section end=Kuon 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Laethe 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you thrust your clenched fist toward the heavens, a soft ivory white pulse of pure spiritual energy rises from its apex, washing over you and those nearby.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Leya 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Niima 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Onar 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Tilamaire 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you thrust your clenched fist upward, a soft golden pulse of pure spiritual energy rises from its apex, washing over you and those nearby.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As CASTER thrusts her clenched fist upward, a soft golden pulse of pure spiritual energy rises from its apex, washing over CASTER and those nearby. &amp;lt;section end=Voaris 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;  &amp;lt;section end=Voln 1613 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 1613 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; As you thrust your clenched fist toward the heavens, a soft grey pulse of pure spiritual energy rises from its apex, washing over you and those nearby.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; As PALADIN thrusts a clenched fist toward the heavens, a soft grey pulse of pure spiritual energy rises from its apex, washing over PALADIN and those nearby. &amp;lt;section end=Other 1613 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Divine Vengeance]] ==&lt;br /&gt;
&lt;br /&gt;
;Pantheon of Liabo&lt;br /&gt;
:A lambent white-gold cloud rolls through the area.&lt;br /&gt;
:TARGET is buffeted by the white-gold cloud and is knocked to the ground.&lt;br /&gt;
&lt;br /&gt;
;Pantheon of Lornon&lt;br /&gt;
:A lucent silvered ebon smoke rolls through the area.&lt;br /&gt;
:TARGET is buffeted by the ebon smoke and is knocked to the ground.&lt;br /&gt;
&lt;br /&gt;
;Pantheon of Neutrality&lt;br /&gt;
:{{addmetext}}&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Divine Strike (1615)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;ocean blue radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with storm grey light, and a glimmering pillar of ocean blue radiance manifests around TARGET. &amp;lt;section end=Charl 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Cholen 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;reddish-orange radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Eonak 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;verdant radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with verdant light, and a glimmering pillar of matching green radiance manifests around TARGET. &amp;lt;section end=Imaera 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;pale grey radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Jastev 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;crimson radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Kai 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;gold and topaz radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with gold and topaz-hued light, and then everything around you shimmers to match the gold and topaz colors.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with gold and topaz-hued light, and a pillar of gold-streaked topaz radiance manifests around TARGET. &amp;lt;section end=Koar 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;swirling white radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Lorminstra 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;glimmering rainbow radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with rainbow-hued light, and then everything around you shimmers to match the glimmering rainbow hues.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with rainbow-hued light, and a glimmering pillar of rainbow radiance manifests around TARGET. &amp;lt;section end=Lumnis 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Oleani 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;sunlight gold radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Phoen 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;darkness&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with silver light, and a pillar of darkness manifests around TARGET. &amp;lt;section end=Ronan 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A glimmering pillar of &#039;&#039;&#039;matching blue radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with sky blue light, and then everything around you shimmers to a matching blue color.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with sky blue light, and a glimmering pillar of matching blue radiance manifests around TARGET. &amp;lt;section end=Tonis 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Andelas 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;dusky red radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with dusky red light, and a glimmering pillar of matching red radiance manifests around TARGET. &amp;lt;section end=Eorgina 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;grey light&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;smoky green radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; Your body surges with power as smoky green radiance coalesces around it!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Ivas 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Luukos 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;roiling blackness&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; Unnatural shadows flicker briefly through CASTER&#039;s eyes, and a pillar of roiling blackness manifests around TARGET.&amp;lt;section end=Marlu 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; Your ora mace surges with power as &#039;&#039;&#039;pale red radiance&#039;&#039;&#039; coalesces around it! [1618 flare]&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Mularos 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;dark amber radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Sheru 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;blood red radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=V&amp;amp;#39;tull 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;dusky silver radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with ice blue light, and a glimmering pillar of dusky silver radiance manifests around TARGET. &amp;lt;section end=Gosaena 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;silver radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with moonlight, and a glimmering pillar of matching silver radiance manifests around TARGET. &amp;lt;section end=Zelia 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;leaf-green radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Aeia 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Amasalen 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Arachne 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;silvery grey haze&#039;&#039;&#039; manifests around a TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Ghezresh 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=The Huntress 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;pure white radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Jaston 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;green-streaked amber radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Kuon 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Laethe 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;deep blue radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Leya 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;aquamarine radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Niima 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;dark shadow&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Onar 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Tilamaire 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;A pillar of rose red radiance manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; &amp;lt;section end=Voaris 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;black-streaked white radiance&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with white light, and then everything around you vanishes into a matching white radiance streaked with pure black.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with pure white light, and a glimmering pillar of black-streaked white radiance manifests around TARGET. &amp;lt;section end=Voln 1615 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 1615 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039; A pillar of &#039;&#039;&#039;grey luminescence&#039;&#039;&#039; manifests around TARGET.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[2p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with silvery grey light, and then everything around you shimmers to match the argentine color.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039; CASTER&#039;s eyes glow with silvery grey light, and a pillar of argentine radiance manifests around TARGET. &amp;lt;section end=Other 1615 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Aid the Fallen (1620)]] ==&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 1620 /&amp;gt;&lt;br /&gt;
:A radiant sea blue beacon encompassed by a translucent emerald corona rapidly descends from above, striking TARGET in the chest. It soon expands to encompass his entire body before finally beginning to wane. The beacon shines brightly one last time and tapers into nonexistence, taking TARGET with it. &amp;lt;section end=Charl 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Cholen 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Eonak 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Imaera 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Jastev 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Kai 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Koar 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Lorminstra 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Lumnis 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Oleani 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Phoen 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 1620 /&amp;gt;&lt;br /&gt;
:A radiant night black beacon encompassed by a translucent silver corona rapidly descends from above, striking Barge in the chest.  It soon expands to encompass his entire body before finally beginning to wane.  The beacon shines brightly one last time and tapers into nonexistence, taking Person with it. &amp;lt;section end=Ronan 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Tonis 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Andelas 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Eorgina 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ivas 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Luukos 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Marlu 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Mularos 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Sheru 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=V&amp;amp;#39;tull 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 1620 /&amp;gt;&lt;br /&gt;
:A radiant silver beacon encompassed by a translucent green corona rapidly descends from above, striking TARGET in the chest. It soon expands to encompass his entire body before finally beginning to wane. The beacon shines brightly one last time and tapers into nonexistence, taking TARGET with it. &amp;lt;section end=Gosaena 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Zelia 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Aeia 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Amasalen 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Arachne 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Ghezresh 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=The Huntress 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Jaston 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 1620 /&amp;gt;&lt;br /&gt;
:A radiant gold beacon encompassed by a translucent brown corona rapidly descends from above, striking TARGET in the chest.  It soon expands to encompass his entire body before finally beginning to wane.  The beacon shines brightly one last time and tapers into nonexistence, taking TARGET with it. &amp;lt;section end=Kuon 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Laethe 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 1620 /&amp;gt;&lt;br /&gt;
:A radiant ivory white beacon encompassed by a translucent deep blue corona rapidly descends from above, striking TARGET in the chest. It soon expands to encompass his entire body before finally beginning to wane. The beacon shines brightly one last time and tapers into nonexistence, taking TARGET with it. &amp;lt;section end=Leya 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Niima 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Onar 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Tilamaire 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Voaris 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Voln 1620 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 1620 /&amp;gt;&lt;br /&gt;
:{{addmetext}} &amp;lt;section end=Other 1620 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
== [[Judgment (1630)]] ==&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the very air behind you ripples like a storm-ravaged ocean. A faint emerald light builds up and emanates from your hand before it takes the shape of an ethereal trident!&lt;br /&gt;
::A chain of lightning erupts from the tip of the ethereal trident, striking TARGET!&lt;br /&gt;
::The ethereal trident dissolves into a spray of seawater.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}} &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Charl 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Cholen 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the repeated sound of metal striking metal rings out in the air around you. A faint golden light builds up and emanates from your hand before it takes the shape of an ethereal forging hammer!&lt;br /&gt;
::A shockwave of golden energy ripples out from the head of the ethereal forging hammer, striking TARGET!&lt;br /&gt;
::The ethereal forging hammer fizzles into a puff of smoke.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Eonak 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the visage of a frolicking doe appears behind you. A faint green light builds up and emanates from your hand before it takes the shape of an ethereal blossom!&lt;br /&gt;
::A swarm of translucent bees spiral from the petals of the ethereal blossom, striking TARGET!&lt;br /&gt;
::The ethereal blossom wilts and then withers away into nothing.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Imaera 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a grey fog roils in and ebbs about your feet.  A faint grey light builds up and emanates from your hand before it takes the shape of an ethereal crystal ball!&lt;br /&gt;
::A veil of grey vapor spews forth from the interior of the ethereal crystal ball, striking &amp;lt;target&amp;gt;!&lt;br /&gt;
::The ethereal crystal ball suddenly implodes upon itself and is gone.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Jastev 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the air behind you darkens with a ruddy crimson mist. A faint silver light builds up and emanates from your hand before your entire arm flashes, becoming solid silver!&lt;br /&gt;
::A flare of silver energy blasts from the fist of the silver arm, striking TARGET!&lt;br /&gt;
::The silver on your arm cracks and breaks apart before blowing away on an errant breeze.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Kai 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a brilliant golden crown haloes your head. A faint white light builds up and emenates from your hand before it takes the shape of an ethereal sceptre!&lt;br /&gt;
::A blast of white energy bursts from the tip of the ethereal sceptre, striking TARGET!&lt;br /&gt;
::The ethereal sceptre in your hand splinters into a crackle of energy.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Koar 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a translucent black gate rises up from the ground behind you. A faint white light builds up and emanates from your hand before it takes the shape of an ethereal chain of keys!&lt;br /&gt;
::A flurry of golden snowflake-shaped motes unwind from the chain of the ethereal keys, striking TARGET!&lt;br /&gt;
::The ethereal keys in your hand slowly melt away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Lorminstra 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Lumnis 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Oleani 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen &amp;lt;section begin=Phoen 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a miniature sun frames the back of your head. A faint blue light builds up and emanates from your hand before it takes the shape of an ethereal chakram!&lt;br /&gt;
::A ray of brilliant sunlight gleams from the edge of the ethereal chakram, striking TARGET!&lt;br /&gt;
::The ethereal chakram flashes brightly and crumbles to dust.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Phoen 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the faint visage of a rearing unicorn appears behind you. A faint black light builds up and emanates from your hand before it takes the shape of an ethereal sword!&lt;br /&gt;
::A plume of silver starlit flames stream from the edge of your ethereal sword, striking TARGET!&lt;br /&gt;
::The ethereal sword in your hand scatters into pinpoints of light that fade away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Ronan 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a golden light spirals around you in a blur.  A faint blue light builds up and emanates from your hand before it takes the shape of an ethereal winged wand!&lt;br /&gt;
::&lt;br /&gt;
::The ethereal winged wand begins to vibrate and flies out of your hand, streaking off into a blur.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::&amp;lt;caster&amp;gt; briefly closes his eyes, and a golden light spirals around him in a blur.  A faint blue light builds up and emanates from &amp;lt;caster&amp;gt;&#039;s hand before it takes the shape of an ethereal winged wand, and &amp;lt;caster&amp;gt; thrusts it forward!&lt;br /&gt;
::&lt;br /&gt;
::The ethereal winged wand begins to vibrate and flies out of &amp;lt;caster&amp;gt;&#039;s hand, streaking off into a blur. &amp;lt;section end=Tonis 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a loud thrumming sound, like that of something purring, rises up near you. A faint black light builds up and emanates from your hand before thin black claws extend from your hand!&lt;br /&gt;
::A volley of black shards gleam from the tip of the claws, striking TARGET!&lt;br /&gt;
::The ethereal claws on your hand slowly retract from view.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Andelas 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a darkened circlet haloes your head. A faint black light builds up and emanates from your hand before it takes the shape of an ethereal bejewelled sceptre!&lt;br /&gt;
::A curl of black flames unravel from the tip of the ethereal sceptre, striking TARGET!&lt;br /&gt;
::The ethereal bejewelled sceptre dissolves into a plume of grey smoke.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Eorgina 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a large, slit-pupiled eye flashes into existence for but a moment behind you. A faint yellow light builds up and emanates from your hand before it takes the shape of an ethereal tome!&lt;br /&gt;
::A flurry of parchment flies out from the inside of the ethereal tome, striking TARGET!&lt;br /&gt;
::The ethereal tome slams shut on its own accord and disappears.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and your form is enveloped by thick smoke. A faint green light builds up and emanates from you before tendrils of green mist coalesce around your arm!&lt;br /&gt;
::A length of a green tentacle bursts out from the tendrils of mist, striking TARGET!&lt;br /&gt;
::The mist enshrouding your arm evaporates into nothing.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Ivas 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Luukos 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the heavy scent of ozone overwhelms the air near you. A faint black-green light builds up and emanates from your hand before it takes on the shape of an ethereal pentacle!&lt;br /&gt;
::A cloud of noxious black-green gas emits from the center of the ethereal pentacle, striking TARGET!&lt;br /&gt;
::The ethereal pentacle pulsates with archaic runes and dissolves into a black ichor.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Marlu 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the air around you is filled with echoing voices in pain. A faint sanguine light builds up and emanates from your hand before it takes on the shape of an ethereal whip!&lt;br /&gt;
::A flurry of sanguine slivers fly from the edge of the ethereal whip, striking TARGET!&lt;br /&gt;
::The ethereal whip coils on itself and fades away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Mularos 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a pair of luminous yellow eyes flash briefly behind you. A faint black light builds up and emanates from you before shadows coalesce and engulf your entire arm!&lt;br /&gt;
::A black jackal-shaped visage leaps from the shadows, striking TARGET!&lt;br /&gt;
::The shadows engulfing your arm fade away into thin tendrils of darkness.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Sheru 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a dark miasma roils about the ground around your feet. A faint black light builds up and emanates from your hand before it takes on the shape of an ethereal scimitar!&lt;br /&gt;
::A torrent of incarnadine essence streams out from the blade of the ethereal scimitar, striking TARGET!&lt;br /&gt;
::The ethereal scimitar violently explodes, leaving nothing to remain.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=V&amp;amp;#39;tull 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a pair of brilliant white, feathered wings unfurl from your back momentarily. A faint silver-grey light builds up and emanates from your hand before it takes on the shape of an ethereal sickle!&lt;br /&gt;
::An arc of silver-grey tendrils spiral out from the blade of the ethereal sickle, striking TARGET!&lt;br /&gt;
::The ethereal sickle departs without a sound.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
::CASTER briefly closes her eyes, and a pair of brilliant white, feathered wings unfurl from her back momentarily. A faint silver-grey light builds up and emanates from Paladin&#039;s hand before it takes on the shape of an ethereal sickle, and CASTER thrusts it forward!&lt;br /&gt;
::An arc of silver-grey tendrils spiral out from the blade of the ethereal sickle, striking TARGET!&lt;br /&gt;
::The ethereal sickle in CASTER&#039;s hand departs without a sound. &amp;lt;section end=Gosaena 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and cacophony of child-like laughter fills the air around you. A faint silver light builds up and emanates from your hand before it takes the shape of an ethereal crescent boomerang!&lt;br /&gt;
::A spiral of multi-hued essence streams out from the edge of the ethereal boomerang, striking TARGET!&lt;br /&gt;
::The ethereal boomerang sprouts limbs, jumps out of your hands and dashes off.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Zelia 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia &amp;lt;section begin=Aeia 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and dozens of wildflowers blossom momentarily around your feet. A faint green light builds up and emanates from your hand before it takes the shape of an ethereal lily-shaped talisman!&lt;br /&gt;
::A number of green vines lash out from the center of the ethereal lily-shaped talisman, striking TARGET!&lt;br /&gt;
::The ethereal lily-shaped talisman&#039;s petals enclose on itself and vanish.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Aeia 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a twinging scent of blood lingers about you. A faint light builds up and emanates from your hand before it takes on a crimson hue. A two-headed purple serpent twines about your wrist!&lt;br /&gt;
::A succession of crimson energy is emitted from the two-headed serpent, striking TARGET!&lt;br /&gt;
::The ethereal serpent writhes about before it fades away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Amasalen 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Arachne 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Ghezresh 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=The Huntress 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Jaston 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a cloud of leaves gently rain down upon you. A faint golden light builds up and emanates from your hand before it takes the shape of an ethereal falarica!&lt;br /&gt;
::A barrage of viridian essence sprays from the blade of the ethereal falarica, striking TARGET!&lt;br /&gt;
::The ethereal falarica slowly decays and falls to the ground as a mass of dead leaves.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Kuon 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Laethe 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the visage of a great owl hovers behind you. A faint ivory light builds up and emanates from your hand before it takes the shape of an ethereal dagger!&lt;br /&gt;
::A streak of ivory energy flares out from the blade of the ethereal dagger, striking TARGET!&lt;br /&gt;
::The ethereal dagger collaspes into ash.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Leya 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the haunting sound of a siren fills the air around you. A faint grey light builds up and emanates from your hand before it takes the shape of an ethereal conch shell!&lt;br /&gt;
::A wave of grey vibrations washes out from the inside of the ethereal conch shell, striking TARGET!&lt;br /&gt;
::The ethereal conch shell shimmers briefly then pops like a bubble.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Niima 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and the image of a broken skull shimmers on your chest before fading away. A faint white light builds up and emanates from your hand before it takes on the shape of an ethereal stiletto!&lt;br /&gt;
::A simple beam of white energy flares out from the tip of the ethereal stiletto, striking TARGET!&lt;br /&gt;
::The ethereal stiletto fades into a shadow before disappearing.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Onar 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Tilamaire 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::{{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
::&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: &lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Voaris 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and your form is shrouded with a radiant white surcoat. A faint white light builds up and emanates from your hand before it takes the shape of an ethereal shield!&lt;br /&gt;
::A surge of white fire blazes from the center of the ethereal shield, striking TARGET!&lt;br /&gt;
::The ethereal shield becomes insubstantial and parts with a whisper.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Voln 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 1630 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[1p]}}&#039;&#039;&#039;&lt;br /&gt;
::You briefly close your eyes, and a faint colorful aura washes over you. A faint multihued light builds up and emanates from your hand before it takes the shape of an ethereal sphere!&lt;br /&gt;
::A blast of multihued plasma flares out from the center of the ethereal sphere, striking TARGET!&lt;br /&gt;
::The ethereal sphere vanishes from sight.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[3p]}}&#039;&#039;&#039;&lt;br /&gt;
:: {{addmetext}}&lt;br /&gt;
::&lt;br /&gt;
:: &amp;lt;section end=Other 1630 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
== [[Divine Incarnation (1650)]] ==&lt;br /&gt;
=== Pantheon of Liabo ===&lt;br /&gt;
&lt;br /&gt;
;Charl &amp;lt;section begin=Charl 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Charl 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Cholen &amp;lt;section begin=Cholen 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Cholen 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eonak &amp;lt;section begin=Eonak 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Eonak 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Imaera &amp;lt;section begin=Imaera 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Imaera 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jastev &amp;lt;section begin=Jastev 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Jastev 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kai &amp;lt;section begin=Kai 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Kai 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Koar &amp;lt;section begin=Koar 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Koar 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lorminstra &amp;lt;section begin=Lorminstra 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Lorminstra 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Lumnis &amp;lt;section begin=Lumnis 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Lumnis 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Oleani &amp;lt;section begin=Oleani 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Oleani 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Phoen  &amp;lt;section begin=Phoen 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Phoen 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ronan &amp;lt;section begin=Ronan 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; Issuing the last syllables of your spell, your vision is momentarily obscured by the image of a star-spangled night sky &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  {{addmetext}}&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; You feel the influence of Ronan leaving you as your vision is momentarily obscured by the image of a star-spangled night sky.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; Your black veil iron katana is suddenly set ablaze with night black flames that swirl in a violent vortex around it!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; Concentrating upon the might of Ronan, you beseech him to guard you and feel his comforting presence settle within you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; Calling upon Ronan to guide your hand, you watch as an ethereal silver scimitar superimposes itself over your katana.  Raising it high over your head, you bring it down upon a human thief and release the full might of Ronan upon him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; You utter a soft prayer to Ronan and feel a familiar lassitude settle over you.  Oddly swift and furious, despite the laconic feeling that wreathes you, you wield your weapon in a dazzling attack against all that surround you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &lt;br /&gt;
&amp;lt;section end=Ronan 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tonis &amp;lt;section begin=Tonis 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; As you attempt to utter the last word of your prayer, you find yourself breathless, and the world around you seems to slow.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &amp;lt;caster&amp;gt; seems to lose his breath on the last word of his prayer as a gold-sparked blue nimbus alights his eyes and his movements grow more swift.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; You feel the influence of Tonis leaving you as you take a deep breath, and the world around you seems to return to its normal speed.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; The gold-sparked blue nimbus cast over &amp;lt;caster&amp;gt;&#039;s eyes fades as he takes a deep breath, and his movements become normal.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; You beseech your patron for combat prowess as sky blue light begins to take form, swirling violently around you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &amp;lt;caster&amp;gt; beseeches his patron as sky blue light begins to take form, swirling violently around him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; Calling on Tonis for his blessing and protection, the air about you warms, and a wan blue glow rises along your shoulders, chest, and back.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; As &amp;lt;caster&amp;gt; calls on Tonis for his blessing and protection, the air about him distorts subtly, and a wan blue glow rises along his shoulders, chest, and back.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; Entreating Tonis to buffet your attacks, flashing wisps of golden energy twine down your arm and coalesce around your &amp;lt;weapon&amp;gt;.  With blinding speed, you unleash a lightning-fast attack upon &amp;lt;target&amp;gt;, the swing of your &amp;lt;weapon&amp;gt; casting a blade of blue force at your enemy.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; Incarnate with power from his patron, &amp;lt;caster&amp;gt; attempts to strike you with an influx of divine energy!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; Uttering a hasty prayer to Tonis, you sense an excess of vitality well within you.  Charging at your enemies, your every step sparks fire to life underfoot, and you wield your &amp;lt;weapon&amp;gt; with inhuman speed in a flurry of strikes.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; As he utters a hasty prayer to Tonis, &amp;lt;caster&amp;gt;&#039;s form is gilded by a vitalizing golden sheen.  &amp;lt;caster&amp;gt; charges at his enemies, his every step sparking fire to life underfoot as he wields his falchion with inhuman speed in a flurry of strikes. &amp;lt;section end=Tonis 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Lornon ===&lt;br /&gt;
&lt;br /&gt;
;Andelas &amp;lt;section begin=Andelas 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Andelas 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Eorgina &amp;lt;section begin=Eorgina 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Eorgina 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Fash&#039;lo&#039;nae &amp;lt;section begin=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Fash&amp;amp;#39;lo&amp;amp;#39;nae 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ivas &amp;lt;section begin=Ivas 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Ivas 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Luukos &amp;lt;section begin=Luukos 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Luukos 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Marlu &amp;lt;section begin=Marlu 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; As you surrender yourself to the horrors of Marlu, six barbed tentacles sprout from your back.  The glistening black limbs drip caustic grime as they flail and snake, driven by your Lord&#039;s awful will.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; A ferocious anger crosses Thresher&#039;s face as six barbed tentacles sprout from his back.  The glistening black limbs drip caustic grime as they flail and snake, seemingly with a will all their own.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; An inhuman roar echoes through your mind as the tentacles sprouting from you retreat into your back.  The agony fades, but an echo of Marlu&#039;s dark malevolence lingers in your soul.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; You beseech your patron for combat prowess as roiling blackness begins to take form, swirling violently around you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; Thresher beseeches his patron as roiling blackness begins to take form, swirling violently around him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; As you beg Marlu for his protection, you feel the barbed tentacles sprouting from your back flex in response.  The tentacles&#039; suckers secrete a noxious black gas, clouding you in a dark haze.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; You call upon the Destroyer to strike, and he hears you, as the tentacles springing from your back huff and spit the foulest of acids.  The tentacles follow your weapon as you strike, spewing their noxious brew at a greater burrow orc&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; The glistening tentacles sprouting from Thresher&#039;s back spring to action as he readies his weapon to strike, moistening themselves with a caustic black acid dripping from their suckers.  Thresher strikes at a greater burrow orc, and the tentacles join their master, huffing and spitting their noxious brew alongside him!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; The darkness of Marlu overwhelms you, hurtling you into a pit of endless despair!  You are only dimly aware of your body&#039;s ferocious combat movements, overwhelmed by the demonic visages swirling around you!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; Invoking the name of Marlu, Thresher leaps to attack!  The glistening black tentacles sprouting from his back mirror his every strike as he lashes out at his enemies with preternatural fury!&amp;lt;section end=Marlu 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Mularos &amp;lt;section begin=Mularos 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Mularos 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Sheru &amp;lt;section begin=Sheru 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; Snarling out the last of your spell, a shadow of black rises to enshroud your form, leaving your features obscured by the darkness.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; You feel the influence of Sheru leaving you as the black pall enshrouding you begins to melt, pouring down your body to dissipate like smoke against the ground.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039;  You beseech your patron for combat prowess as dark amber radiance begins to take form, swirling violently around you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; Invoking Sheru&#039;s name to safeguard against harm, you feel a tremor ripple across your shoulders, like the rising of hackles, before it blankets your chest and back.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; As you cast your prayers for guidance to Sheru, you are answered by a howl torn from the depths of a nightmare.  A pulse of lustrous black light suffuses your sword, and you unleash a violent strike upon a jungle troll chieftain, the wallop of your sword distorting the air.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; As you utter a laconic prayer to Sheru, you are suffused with a ruthlessness beyond comprehension as an ebony shroud settles on you.  Your grip on your sword tightens painfully as you strike out at all that surrounds you in a barrage of cold and calculated fury.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Sheru 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;V&#039;tull &amp;lt;section begin=V&amp;amp;#39;tull 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=V&amp;amp;#39;tull 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Pantheon of Neutrality ===&lt;br /&gt;
&lt;br /&gt;
;Gosaena &amp;lt;section begin=Gosaena 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Gosaena 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Zelia &amp;lt;section begin=Zelia 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; Giggling the last syllables of your spell, your vision is momentarily obscured by a silver nimbus that is reminiscent of moonlight through leaves.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; As Kaight giggles the last syllable of his spell, a silver nimbus that is reminiscent of moonlight through leaves formulates before him and settles over his eyes.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; You feel the influence of Zeila leaving you as your vision is momentarily obscured by bands of moonlight.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; The silvery moonlight that fills Kaight&#039;s eyes slowly fades away.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; You beseech your patron for combat prowess as silver radiance begins to take form, swirling violently around you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; Kaight beseeches his patron as silver radiance begins to take form, swirling violently around him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; Concentrating upon the release of Zelia, you beseech her to guard you and feel her chaotic presence beat restlessly upon your shoulders, back, and chest.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; A brief look of wild exhilaration flits across Kaight&#039;s face and is immediately followed by a chaotic silver nimbus that beats restlessly upon his shoulders, chest, and back.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; Calling upon Zelia to guide your hand, you watch as a silver chakram superimposes itself over your no-dachi.  Raising it high over your head, you bring it down upon a massive black boar and release the full chaos of Zelia upon him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; Superimposed over Kaight&#039;s no-dachi is the image of a silver chakram. He raises his no-dachi high overhead and strikes down upon a massive black boar, releasing the full chaos of Zelia upon him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; You utter a random disjointed prayer to Zelia and feel a familiar giddiness overtake you.  Malleable and fickle, you wield your weapon in an erratic attack against all that surround you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; Uttering a random, disjointed prayer to Zelia, Kaight is suddenly bathed in pale moonlight and laughter. Kaight becomes a blur of motion, the movements blinding, like flashes of moonlight slipping through leaves, as he strikes out at his foes with divine fervor.&amp;lt;section end=Zelia 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Lesser Spirits ===&lt;br /&gt;
&lt;br /&gt;
;Aeia  &amp;lt;section begin=Aeia 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Aeia 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Amasalen &amp;lt;section begin=Amasalen 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Amasalen 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Kuon 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Arachne &amp;lt;section begin=Arachne 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Arachne 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Ghezresh &amp;lt;section begin=Ghezresh 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Ghezresh 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;The Huntress &amp;lt;section begin=The Huntress 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039;  Your vision is overcome by a great and endless desert.  Though survival is impossible here, a promise of vengeance feeds you, quenches you, drives you.  The vision clears, but the thirst for blood remains.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  XXX&#039;s eyes appear to lose focus for a moment as she gazes into the distance.  A bloody eight-pointed star digs itself into her forehead as if cut there by some invisible dagger, and a grim determination settles upon her visage.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039;  You sense yourself in the desert once more, your every sense heightened by the desperate drive to live another day.  You feel the power of The Huntress wane, and your vision of the desert dissipates, but the feeling remains.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039;  As XXX gazes into the distance, the bloody eight-pointed star disappears from her forehead, stroke by stroke, as if un-carved by an invisible dagger.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039;  You beseech your patron for combat prowess as faintly silver glow begins to take form, swirling violently around you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039;  XXX beseeches her patron as faintly silver glow begins to take form, swirling violently around her.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039;  Your vision is overcome by a cave littered with the broken bodies of spiders.  You take their limbs and drink of them, invigorated by their venomous entrails.  A bloody haze enshrouds you, protecting you from your enemies.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039;  XXX&#039;s limbs tense as the sound of chittering can be heard in the distance.  A blood red haze materializes to enshroud Svantai, protecting her from her enemies.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039;  You supplicate the Huntress to guide your weapon well.  She responds by enshrouding your skull-crusher in a blood red haze, its tendrils licking the air violently, ready to slash at a black forest viper as you raise it to strike!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039;  XXX dictates a spiteful prayer, and a blood red haze enshrouds her skull-crusher in response, its tendrils licking the air violently, ready to slash at a black forest viper as she raises it to strike!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039;  A predatory instinct infuses you as you look upon your enemies.  You thirst for their blood, and the Huntress hears your call.  As you begin to attack, you feel her power guide your every strike and riposte, inspired by her quest for endless vengeance!&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039;  XXX adopts a predatory posture as she looks upon her enemies.  She begins to attack, her every strike and riposte inspired by a dark and holy power!&amp;lt;section end=The Huntress 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Jaston &amp;lt;section begin=Jaston 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Jaston 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Kuon &amp;lt;section begin=Kuon 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Kuon 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Laethe &amp;lt;section begin=Laethe 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Laethe 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Leya &amp;lt;section begin=Leya 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; With reverent fervor, the last syllables of your spell leave you in a hush, and your vision shifts to a field of azure. &amp;lt;br&amp;gt; The scent of sweet trillium wafts about you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; As the last syllables leave Person in a reverent hush, her eyes cloud over with azure, and the scent of sweet trillium fills the air.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; You feel the influence of Leya leaving you as your field of vision clears and the azure haze is swept away as if by a breeze.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; Slowly, the azure haze in Person&#039;s eyes fades to nothingness.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; You beseech your patron for combat prowess as deep blue radiance begins to take form, swirling violently around you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; Person beseeches her patron as deep blue radiance begins to take form, swirling violently around her.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; Channeling the righteous passion of the Amazon, you entreat her blessing and feel the mantle ofher strength drape across your shoulders, back, and chest.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; The azure mantle surrounding Person suddenly disappears.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; You direct your devotions inward, entreating Leya to lend you her strength and mercy.  A tremor thrums along your arm as a silver dagger is superimposed over your falchion, and you thrust it toward a dwarven brigand with the command of the Amazon&#039;s prowess at your disposal.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; Person takes a deep breath, and a certain stillness seems to settle over her as a subtle silver sheen races along her arm to manifest as a dagger superimposed over her falchion.  She lunges at a dwarven brigand with a martial prowess likened only to that of Leya.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; Your breath catches on the words of your prayer, and you silently mouth each syllable as tendrils of silver begin to twine down your arm.  The energy coalesces in your hand as a sharp dagger, and with all the martial prowess of a master combatant, your strikes are possessed of the strength that comes with such confidence.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; Person lips move over a silent prayer, and tendrils of silver begin to twine down her arm, coalescing in her hand as a sharp dagger.  With the martial prowess of a master combatant, her strikes are possessed of the strength that comes with such confidence. &amp;lt;section end=Leya 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Niima &amp;lt;section begin=Niima 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Niima 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Onar &amp;lt;section begin=Onar 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Onar 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Tilamaire &amp;lt;section begin=Tilamaire 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Tilamaire 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voaris &amp;lt;section begin=Voaris 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039;  &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Voaris 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
;Voln &amp;lt;section begin=Voln 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; Precisely murmuring the last syllables of your spell, your vision is momentarily obscured by twin orbs of black and white that swirl about you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; As Teveriel precisely murmurs the last syllable of his spell, twin orbs of white and black settle over his eyes.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; You feel the influence of Voln leaving you as your vision is momentarily obscured by twin orbs of black and white that fuse into a single shield.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; The twin orbs of black and white that reside within Teveriel&#039;s face slowly fade away. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; You beseech your patron for combat prowess as black-streaked white radiance begins to take form, swirling violently around you.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; Teveriel beseeches his patron as black-streaked white radiance begins to take form, swirling violently around him.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; Concentrating upon the martial prowess of Voln, you beseech him to guard you and feel the solid, reassuring presence of the Paladin as he rests his hand upon first your shoulders, then your back, and lastly your chest.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; A brief look of determination travels across Teveriel&#039;s face and is immediately followed by a white-veined ebon nimbus settling over his shoulders, chest, and back.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; Calling upon the martial might of Voln to guide your hand, you watch as an ebon longsword wreathed in brilliant white flames superimposes itself over your warblade.  Raising it high over your head, you thrust it in a sweeping arc at a shrickhen and sear him with holy fire.&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; Superimposed over Teveriel&#039;s warblade is the image of an ebon longsword wreathed in brilliant white flames.  He raises his warblade high overhead, then trusts it in a sweeping arc at a shrickhen and sears it with holy fire&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; You utter a short, martial prayer to Voln and feel a familiar stoic efficiency sweep over you.  Determined and uplifted, you wield your weapon in a fiery, brilliant white arc at all that surround you. &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; Uttering a short, martial prayer to Voln, Teveriel is suddenly encircled by a brilliant white nimbus.  Teveriel becomes a blur of motion, the movements determined and firm, as he strikes out at his enemies with divine fervor.&amp;lt;section end=Voln 1650 /&amp;gt;&lt;br /&gt;
&lt;br /&gt;
=== Unaligned ===&lt;br /&gt;
;Other &amp;lt;section begin=Other 1650 /&amp;gt;&lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 1p]}}&#039;&#039;&#039; {{addmetext}} &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Cast 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Expiration 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Zeal 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Armor 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Smite 3p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 1p]}}&#039;&#039;&#039; &lt;br /&gt;
:&#039;&#039;&#039;{{Smallcaps|[Onslaught 3p]}}&#039;&#039;&#039; &amp;lt;section end=Other 1650 /&amp;gt;&lt;br /&gt;
{{top}}&lt;br /&gt;
&lt;br /&gt;
[[Category:Arkati]]&lt;br /&gt;
[[Category:Cleric]]&lt;br /&gt;
[[Category:Paladin]]&lt;/div&gt;</summary>
		<author><name>SYNATHAESIA</name></author>
	</entry>
</feed>