BVShop:Spellbound/February 2022: Difference between revisions

The official GemStone IV encyclopedia.
< BVShop:Spellbound
Jump to navigation Jump to search
(Created Feb 2022 Iteration)
 
(Feb 2022 update)
 
(2 intermediate revisions by 2 users not shown)
Line 7: Line 7:
|location=[Map Room 16], Lich# 26877, go narrow space
|location=[Map Room 16], Lich# 26877, go narrow space
|fest=dr|year=2022|letter=S}}
|fest=dr|year=2022|letter=S}}
===Spellbound===<!--==={{{ [Spellbound] 26878 2022-02-11}}}===-->
===Spellbound===<!--==={{{ [Spellbound] 26878 2022-02-25 17:06:14 -0500}}}===-->
{{RoomDescription|
{{RoomDescription|
|roomname=Spellbound - 26878
|roomname=Spellbound - 26878 - ( 8212545 )
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a wave-painted brick door.
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a wave-painted brick door.
|exits= south, out}}
|exits= south, out}}
{{sign|margin-right=40%|sign='''dust-covered note'''<hr><nowiki>
{{sign|margin-right=40%|sign='''dust-covered note'''<hr><nowiki>
Items in the case are magical trinkets which automatically recharge daily:
Items in the case are magical trinkets which automatically recharge daily. INSPECT each one to learn which spell they cast and how many charges are available per day.</nowiki>}}

Green Leaf Symbol: Phoen's Strength (606) - 1x/day
Shiny Templar Symbol: Dauntless (1606) - 1x/day
Shiny Knight Pin: Bravery (211) - 1x/day
Iron Shard Pin: Iron Skin (1202) - 1x/day
Turquoise Gemstone: Shroud of Deception (1212) - 1x/day
Mossbark Bark: Barkskin (605) - 3x/day
Grasping Arms Stickpin: Grasp of the Grave (709) - 20x/day
Gate Clasp: Minor Sanctuary (213) - 3x/day
Collection Bowl Trinket: Relieve Burden (314) - 1x/day

Mutli-cast wands (casts all spells simultaneously):

Spiral Crystal Wand: Spirit Dispel (119), Elemental Dispel (417), Mental Dispel (1218) - 10x/day
Crystal Baton - Bane/Smite (302), Chromatic Circle (502), Mana Disruption (702), Heal/Harm (1101) - 40x/day
Luminescent Baton: Elemental Defense I (401), Elemental Defense II (406), Elemental Defense III (414) - 1x/day
Cloud-enruned Scepter: Stun Cloud (1704), Death Cloud (1713), Quake (1714), Firestorm (1715) - 40x/day

New potions on the shelf! The absinthe green tincture significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The pearlescent purple philter significantly increases one's ensorcelling skill and comes with 1 dose. The blue-violet infusion significantly increases one's loresong unlocking skill and comes with 1 dose. Lastly, the dilute copper ayan'eth potions (8x), dilute silver ayan'eth potions (9x), and dilute golden ayan'eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.</nowiki>}}
<blockquote>
<blockquote>
{{Container2||container=In the sigil-incised display case you see:||contents= a green leaf symbol, a metallic shiny templar symbol, a shining knight pin, a small iron shard pin, a large turquoise gemstone, some mossbark bark, a grasping arms stickpin, a metal gate clasp, a golden collection bowl trinket, a slender spiral crystal wand, a multi-facet crystal baton, a cloud-enruned scepter and a small luminescent baton.}}
{{Container2||container=In the sigil-incised display case you see:||contents= a twisted white alloy wand, a wavy metal shard, a ruby-inset charm dangling two silver talons, a green shield clasp, a floating eye trinket, an emerald vine clasp, a shimmering shield stickpin, a crystal shard pin, a white alloy crown symbol, a golden muffin clasp and a blue mithril symbol.}}
{| class="wikitable col-5-right" {{prettytable}}
{| class="wikitable col-5-right" {{prettytable}}
| a green leaf symbol || Weight: <1 pound || pin-worn<br>functional|| [[Phoen's Strength]]<br>1x/day<br>raise activated || 15,000
| a twisted white alloy wand || Weight: <1 pound || pin-worn<br>functional|| [[Neutralize Curse]]<br>1x/day<br>wave activated || 10,000
|-
|-
| a metallic shiny templar symbol || Weight: <1 pound || pin-worn<br>functional|| [[Dauntless]]<br>1x/day<br>raise activated || 20,000
| a wavy metal shard || Weight: <1 pound || pin-worn<br>functional|| [[Mass Blur]]<br>1x/day<br>raise activated || 15,000
|-
|-
| a shining knight pin || Weight: <1 pound || pin-worn<br>functional|| [[Bravery]]<br>1x/day<br>raise activated || 15,000
| a ruby-inset charm dangling two silver talons || Weight: <1 pound || pin-worn<br>functional|| [[Dragonclaw]]<br>1x/day<br>raise activated || 10,000
|-
|-
| a small iron shard pin || Weight: <1 pound || pin-worn<br>functional|| [[Iron Skin]]<br>1x/day<br>raise activated || 10,000
| a green shield clasp || Weight: <1 pound || pin-worn<br>functional|| [[Vigor]]<br>1x/day<br>raise activated || 10,000
|-
|-
| a large turquoise gemstone || Weight: <1 pound || pin-worn<br>functional|| [[Shroud of Deception]]<br>1x/day<br>raise activated || 10,000
| a floating eye trinket || Weight: <1 pound || pin-worn<br>functional|| [[Eye Spy]]<br>1x/day<br>raise activated || 7,500
|-
|-
| some mossbark bark || Weight: <1 pound || pin-worn<br>functional|| [[Barkskin]]<br>3x/day<br>tap activated || 7,500
| an emerald vine clasp || Weight: <1 pound || pin-worn<br>functional|| [[Camouflage]]<br>5x/day<br>rub activated || 20,000
|-
|-
| a grasping arms stickpin || Weight: <1 pound || pin-worn<br>functional|| [[Grasp of the Grave]]<br>20x/day<br>rub activated || 15,000
| a shimmering shield stickpin || Weight: <1 pound || pin-worn<br>functional|| [[Elemental Deflection]]<br>2x/day<br>raise activated || 15,000
|-
|-
| a metal gate clasp || Weight: <1 pound || pin-worn<br>functional|| [[Minor Sanctuary]]<br>3x/day<br>raise activated || 15,000
| a crystal shard pin || Weight: <1 pound || pin-worn<br>functional|| [[Mana Focus]]<br>2x/day<br>tap activated || 15,000
|-
|-
| a golden collection bowl trinket || Weight: <1 pound || pin-worn<br>functional|| [[Relieve Burden]]<br>1x/day<br>raise activated || 10,000
| a white alloy crown symbol || Weight: <1 pound || pin-worn<br>functional|| [[Warding Sphere]]<br>1x/day<br>raise activated || 15,000
|-
|-
| a slender spiral crystal wand || Weight: <1 pound || ||[[Spirit Dispel]](119),[[Elemental Dispel]](417),[[Mental Dispel]](1218)<br>10x/day<br>wave activated || 20,000
| a golden muffin clasp || Weight: <1 pound || pin-worn<br>functional|| [[Manna]]<br>2x/day<br>raise activated || 7,500
|-
|-
| a multi-facet crystal baton || Weight: <1 pound || ||[[Smite]](302),[[Chromatic Circle]](502),[[Mana Disruption]](702),[[Harm]](1101)<br>40x/day<br>wave activated || 20,000
| a blue mithril symbol || Weight: <1 pound || pin-worn<br>functional|| [[Spirit Defense]]<br>3x/day<br>raise activated || 10,000
|-
| a cloud-enruned scepter || Weight: <1 pound || || [[Stun Cloud]](1704),[[Death Cloud]](1713),[[Quake]](1714),[[Firestorm]](1715)<br>40x/day<br>raise activated || 25,000
|-
| a small luminescent baton || Weight: <1 pound || || [[Elemental Defense I]](401),[[Elemental Defense II]](406),[[Elemental Defense III]](414)<br>1x/day<br>wave activated || 15,000
|-
|-
|}
|}
{{Container2||container=In the rune-covered wooden crate you see:||contents= a heavy invar necklace set with square-cut rubies, a diamond-linked silver necklace dangling tiny sapphires and a twisted rose gold necklace accented with dark aquamarine rosettes.}}
{{Container2||container=In the rune-covered wooden crate you see:||contents= a twisted rose gold necklace accented with dark aquamarine rosettes, a diamond-linked silver necklace dangling tiny sapphires and a heavy invar necklace set with square-cut rubies.}}
{| class="wikitable col-5-right" {{prettytable}}
{| class="wikitable col-5-right" {{prettytable}}
| a heavy invar necklace set with square-cut rubies || Weight: <1 pound || neck-worn
| a twisted rose gold necklace accented with dark aquamarine rosettes || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-aheavyinvarnecklacesetwithsquare-cutrubies" role="link" style="text-decoration: underline">analyze, examine</div>
| <div class="mw-customtoggle-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarnecklacesetwithsquare-cutrubies">'''Analyze:'''<br>You analyze the invar necklace and sense that the creator has provided the following information:<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes">'''Analyze:'''<br>You analyze the rose gold necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br>
'''Examine:'''<br>The necklace is made from a perfect sphere of polished moonstone. Silver light shines out in a large, radiant near-full orb, reflecting Liabo's current phase. A delicate setting of pure platinum holds the miniature moon.
'''Examine:'''<br>The necklace is made from a perfect sphere of polished opal. Pearlescent light shines out in a lambent sliver from the stone, reflecting Lornon's current waning crescent phase. A simple setting of pure platinum holds the miniature moon.
</div>
</div>
| 25,000
| 25,000
|-
|-
| a diamond-linked silver necklace dangling tiny sapphires || Weight: <1 pound || neck-worn
| a diamond-linked silver necklace dangling tiny sapphires || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-adiamond-linkedsilvernecklacedanglingtinysapphires" role="link" style="text-decoration: underline">analyze, examine</div>
| <div class="mw-customtoggle-adiamond-linkedsilvernecklacedanglingtinysapphires" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adiamond-linkedsilvernecklacedanglingtinysapphires">'''Analyze:'''<br>You analyze the silver necklace and sense that the creator has provided the following information:<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adiamond-linkedsilvernecklacedanglingtinysapphires">'''Analyze:'''<br>You analyze the silver necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br>
'''Examine:'''<br>The necklace is made from a perfectly spherical star ruby. Crimson light shines out in a large, radiant near-full orb, reflecting Tilaok's current phase. The stone's star flares and quiets, as if barely containing its excitement. An elegant setting of pure platinum holds the miniature moon.
</div>
</div>
| 25,000
| 25,000
|-
|-
| a twisted rose gold necklace accented with dark aquamarine rosettes || Weight: <1 pound || neck-worn
| a heavy invar necklace set with square-cut rubies || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes" role="link" style="text-decoration: underline">analyze, examine</div>
| <div class="mw-customtoggle-aheavyinvarnecklacesetwithsquare-cutrubies" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes">'''Analyze:'''<br>You analyze the rose gold necklace and sense that the creator has provided the following information:<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarnecklacesetwithsquare-cutrubies">'''Analyze:'''<br>You analyze the invar necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br>
'''Examine:'''<br>The necklace is made from a perfect sphere of polished opal. Pearlescent light shines out in a large, radiant just-waning orb, reflecting Lornon's current phase. A simple setting of pure platinum holds the miniature moon.
</div>
</div>
| 25,000
| 25,000
|-
|-
|}
|}
{{Container2||container=On the small round table you see:||contents= a smoke-tinted rolaren monocle, a rose-tinged bronze monocle, a silver squiggly-framed monocle and a filigreed gold-tinted monocle.}}
{{Container2||container=On the small round table you see:||contents= a filigreed gold-tinted monocle, a silver squiggly-framed monocle, a rose-tinged bronze monocle and a smoke-tinted rolaren monocle.}}
{| class="wikitable col-5-right" {{prettytable}}
{| class="wikitable col-5-right" {{prettytable}}
| a smoke-tinted rolaren monocle || Weight: <1 pound ||
| a filigreed gold-tinted monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-asmoke-tintedrolarenmonocle" role="link" style="text-decoration: underline">analyze</div>
| <div class="mw-customtoggle-afiligreedgold-tintedmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoke-tintedrolarenmonocle">'''Analyze:'''<br>You analyze the rolaren monocle and sense that the creator has provided the following information:<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afiligreedgold-tintedmonocle">'''Analyze:'''<br>You analyze the gold-tinted monocle and sense that the creator has provided the following information:<br>
A smoke-tinted rolaren monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
A filigreed gold-tinted monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Line 102: Line 77:
| 1,500
| 1,500
|-
|-
| a rose-tinged bronze monocle || Weight: <1 pound ||
| a silver squiggly-framed monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-arose-tingedbronzemonocle" role="link" style="text-decoration: underline">analyze</div>
| <div class="mw-customtoggle-asilversquiggly-framedmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-arose-tingedbronzemonocle">'''Analyze:'''<br>You analyze the bronze monocle and sense that the creator has provided the following information:<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilversquiggly-framedmonocle">'''Analyze:'''<br>You analyze the squiggly-framed monocle and sense that the creator has provided the following information:<br>
A rose-tinged bronze monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
A silver squiggly-framed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Line 112: Line 87:
| 1,500
| 1,500
|-
|-
| a silver squiggly-framed monocle || Weight: <1 pound ||
| a rose-tinged bronze monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-asilversquiggly-framedmonocle" role="link" style="text-decoration: underline">analyze</div>
| <div class="mw-customtoggle-arose-tingedbronzemonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilversquiggly-framedmonocle">'''Analyze:'''<br>You analyze the squiggly-framed monocle and sense that the creator has provided the following information:<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-arose-tingedbronzemonocle">'''Analyze:'''<br>You analyze the bronze monocle and sense that the creator has provided the following information:<br>
A silver squiggly-framed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
A rose-tinged bronze monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Line 122: Line 97:
| 1,500
| 1,500
|-
|-
| a filigreed gold-tinted monocle || Weight: <1 pound ||
| a smoke-tinted rolaren monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-afiligreedgold-tintedmonocle" role="link" style="text-decoration: underline">analyze</div>
| <div class="mw-customtoggle-asmoke-tintedrolarenmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afiligreedgold-tintedmonocle">'''Analyze:'''<br>You analyze the gold-tinted monocle and sense that the creator has provided the following information:<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoke-tintedrolarenmonocle">'''Analyze:'''<br>You analyze the rolaren monocle and sense that the creator has provided the following information:<br>
A filigreed gold-tinted monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
A smoke-tinted rolaren monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
Line 133: Line 108:
|-
|-
|}
|}
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a smooth turquoise leather journal embossed with a peacock feather, an ivory suede-spined gold puma fur-covered ledger, a translucent gold and teal bottle, a twine-wrapped smoky grey jar, a gold-leafed shimmering pink bottle, a black-eyed skull-shaped jar, a shimmering certificate, a glittering ticket, a dilute golden ayan'eth potion, a dilute silver ayan'eth potion, a dilute copper ayan'eth potion, a pale blue-violet infusion, an absinthe green tincture, a pearlescent purple philter and a shimmering trinket.}}
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a sparkling white elixir, a moss green mixture, a shimmering trinket, a pearlescent purple philter, an absinthe green tincture, a pale blue-violet infusion, a dilute copper ayan'eth potion, a dilute silver ayan'eth potion, a dilute golden ayan'eth potion, a glittering ticket, a shimmering certificate, a black-eyed skull-shaped jar, a gold-leafed shimmering pink bottle, a twine-wrapped smoky grey jar, a translucent gold and teal bottle, an ivory suede-spined gold puma fur-covered ledger and a smooth turquoise leather journal embossed with a peacock feather.}}
{| class="wikitable col-5-right" {{prettytable}}
{| class="wikitable col-5-right" {{prettytable}}
| a smooth turquoise leather journal embossed with a peacock feather || Weight: <1 pound ||
| a sparkling white elixir || Weight: <1 pound ||
| <div class="mw-customtoggle-asmoothturquoiseleatherjournalembossedwithapeacockfeather" role="link" style="text-decoration: underline">analyze</div>
| Sanctifying boost, 1 dose<br><div class="mw-customtoggle-asparklingwhiteelixir" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothturquoiseleatherjournalembossedwithapeacockfeather">'''Analyze:'''<br>This leather journal is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asparklingwhiteelixir">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this elixir. A bard may be able to provide more specifics.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>
</div>
</div>
| 2,000
| 50,000
|-
|-
| an ivory suede-spined gold puma fur-covered ledger || Weight: <1 pound ||
| a moss green mixture || Weight: <1 pound ||
| <div class="mw-customtoggle-anivorysuede-spinedgoldpumafur-coveredledger" role="link" style="text-decoration: underline">analyze</div>
| Resist Nature boost, 1 dose<br><div class="mw-customtoggle-amossgreenmixture" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anivorysuede-spinedgoldpumafur-coveredledger">'''Analyze:'''<br>This fur-covered ledger is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-amossgreenmixture">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this mixture. A bard may be able to provide more specifics.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>
</div>
</div>
| 2,000
| 25,000
|-
|-
| a translucent gold and teal bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100
| a shimmering trinket || Weight: <1 pound || pin-worn|| [[Shimmer Trinket]]
<div class="mw-customtoggle-ashimmeringtrinket" role="link" style="text-decoration: underline">examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Examine:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.
</div>
| 5,000
|-
|-
| a twine-wrapped smoky grey jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100
| a pearlescent purple philter || Weight: <1 pound ||
| Ensorcelling boost, 1 dose<br><div class="mw-customtoggle-apearlescentpurplephilter" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apearlescentpurplephilter">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this philter. A bard may be able to provide more specifics.<br>
</div>
| 50,000
|-
|-
| an absinthe green tincture || Weight: <1 pound ||
| a gold-leafed shimmering pink bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250
| Enchanting boost, 5 doses<br><div class="mw-customtoggle-anabsinthegreentincture" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anabsinthegreentincture">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this tincture. A bard may be able to provide more specifics.<br>
</div>
| 50,000
|-
|-
| a black-eyed skull-shaped jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250
| a pale blue-violet infusion || Weight: <1 pound ||
| Loresinging boost, 1 dose<br><div class="mw-customtoggle-apaleblue-violetinfusion" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apaleblue-violetinfusion">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this infusion. A bard may be able to provide more specifics.<br>
</div>
| 10,000
|-
|-
| a shimmering certificate || Weight: <1 pound || || Unlock - add 1 maximum charge to an existing Shimmer Trinket.
| a dilute copper ayan'eth potion || Weight: 2 pounds || || [[Enchanting potion]] - 8x, 5 doses || 20,000
|-
| 1,000
| a dilute silver ayan'eth potion || Weight: 2 pounds || || [[Enchanting potion]] - 9x, 5 doses || 25,000
|-
|-
| a dilute golden ayan'eth potion || Weight: 2 pounds || || [[Enchanting potion]] - 10x, 5 doses || 30,000
| a glittering ticket || Weight: <1 pound || || Unlock - add 1 appearance set to an existing Shimmer Trinket<div class="mw-customtoggle-aglitteringticket" role="link" style="text-decoration: underline">analyze, examine</div>
|-
| a glittering ticket || Weight: <1 pound || || Unlock - add 1 appearance set to an existing Shimmer Trinket
<div class="mw-customtoggle-aglitteringticket" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br> Your ticket is used to unlock the potential of things held in your other hand.<br><br> The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br><br> You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br><br> Your ticket may not be altered or changed in any way.<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br> Your ticket is used to unlock the potential of things held in your other hand.<br><br> The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br><br> You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br><br> Your ticket may not be altered or changed in any way.<br>
'''Examine:'''<br>This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
'''Examine:'''<br>This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
Line 168: Line 159:
| 3,500
| 3,500
|-
|-
| a dilute golden ayan'eth potion || Weight: 2 pounds || || [[Enchanting potion]] - 10x, 5 doses || 30,000
| a shimmering certificate || Weight: <1 pound || || Unlock - add 1 maximum charge to an existing Shimmer Trinket
<div class="mw-customtoggle-ashimmeringcertificate" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringcertificate">'''Analyze:'''<br> Your certificate is used to unlock the potential of things held in your other hand.<br><br> The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.<br><br> You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.<br><br> Your certificate may not be altered or changed in any way.<br>
'''Examine:'''<br>This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.
</div>
| 1,000
|-
|-
| a black-eyed skull-shaped jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items
| a dilute silver ayan'eth potion || Weight: 2 pounds || || [[Enchanting potion]] - 9x, 5 doses || 25,000
|| 250
|-
|-
| a gold-leafed shimmering pink bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items
| a dilute copper ayan'eth potion || Weight: 2 pounds || || [[Enchanting potion]] - 8x, 5 doses || 20,000
|| 250
|-
|-
| a pale blue-violet infusion || Weight: <1 pound ||
| a twine-wrapped smoky grey jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items
|| 100
| Loresinging boost, 1 dose<div class="mw-customtoggle-apaleblue-violetinfusion" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apaleblue-violetinfusion">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this infusion. A bard may be able to provide more specifics.<br>
</div>
| 10,000
|-
|-
| a translucent gold and teal bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items
| an absinthe green tincture || Weight: <1 pound ||
|| 100
| Enchanting boost, 5 doses<div class="mw-customtoggle-anabsinthegreentincture" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anabsinthegreentincture">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this tincture. A bard may be able to provide more specifics.<br>
</div>
| 50,000
|-
|-
| a pearlescent purple philter || Weight: <1 pound ||
| an ivory suede-spined gold puma fur-covered ledger || Weight: <1 pound ||
| Ensorcelling boost, 1 dose<div class="mw-customtoggle-apearlescentpurplephilter" role="link" style="text-decoration: underline">analyze</div>
| <div class="mw-customtoggle-anivorysuede-spinedgoldpumafur-coveredledger" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apearlescentpurplephilter">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this philter. A bard may be able to provide more specifics.<br>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anivorysuede-spinedgoldpumafur-coveredledger">'''Analyze:'''<br>This fur-covered ledger is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>
</div>
</div>
| 50,000
| 2,000
|-
|-
| a smooth turquoise leather journal embossed with a peacock feather || Weight: <1 pound ||
| a shimmering trinket || Weight: <1 pound || pin-worn|| [[Shimmer Trinket]]<div class="mw-customtoggle-ashimmeringtrinket" role="link" style="text-decoration: underline">examine</div>
| <div class="mw-customtoggle-asmoothturquoiseleatherjournalembossedwithapeacockfeather" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Examine:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothturquoiseleatherjournalembossedwithapeacockfeather">'''Analyze:'''<br>This leather journal is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>
</div>
</div>
| 5,000
| 2,000
|-
|-
|}
|}

Latest revision as of 16:15, 25 February 2022

2022Q1

a narrow space between two buildings, [Map Room 16], Lich# 26877, go narrow space

Spellbound

[Spellbound - 26878 - ( 8212545 )]
With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a wave-painted brick door.
Obvious exits: south, out
dust-covered note
Items in the case are magical trinkets which automatically recharge daily. INSPECT each one to learn which spell they cast and how many charges are available per day.

In the sigil-incised display case you see: a twisted white alloy wand, a wavy metal shard, a ruby-inset charm dangling two silver talons, a green shield clasp, a floating eye trinket, an emerald vine clasp, a shimmering shield stickpin, a crystal shard pin, a white alloy crown symbol, a golden muffin clasp and a blue mithril symbol.

a twisted white alloy wand Weight: <1 pound pin-worn
functional
Neutralize Curse
1x/day
wave activated
10,000
a wavy metal shard Weight: <1 pound pin-worn
functional
Mass Blur
1x/day
raise activated
15,000
a ruby-inset charm dangling two silver talons Weight: <1 pound pin-worn
functional
Dragonclaw
1x/day
raise activated
10,000
a green shield clasp Weight: <1 pound pin-worn
functional
Vigor
1x/day
raise activated
10,000
a floating eye trinket Weight: <1 pound pin-worn
functional
Eye Spy
1x/day
raise activated
7,500
an emerald vine clasp Weight: <1 pound pin-worn
functional
Camouflage
5x/day
rub activated
20,000
a shimmering shield stickpin Weight: <1 pound pin-worn
functional
Elemental Deflection
2x/day
raise activated
15,000
a crystal shard pin Weight: <1 pound pin-worn
functional
Mana Focus
2x/day
tap activated
15,000
a white alloy crown symbol Weight: <1 pound pin-worn
functional
Warding Sphere
1x/day
raise activated
15,000
a golden muffin clasp Weight: <1 pound pin-worn
functional
Manna
2x/day
raise activated
7,500
a blue mithril symbol Weight: <1 pound pin-worn
functional
Spirit Defense
3x/day
raise activated
10,000

In the rune-covered wooden crate you see: a twisted rose gold necklace accented with dark aquamarine rosettes, a diamond-linked silver necklace dangling tiny sapphires and a heavy invar necklace set with square-cut rubies.

a twisted rose gold necklace accented with dark aquamarine rosettes Weight: <1 pound neck-worn
analyze, examine
Analyze:
You analyze the rose gold necklace and sense that the creator has provided the following information:

This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.
Examine:
The necklace is made from a perfect sphere of polished opal. Pearlescent light shines out in a lambent sliver from the stone, reflecting Lornon's current waning crescent phase. A simple setting of pure platinum holds the miniature moon.

25,000
a diamond-linked silver necklace dangling tiny sapphires Weight: <1 pound neck-worn
analyze
Analyze:
You analyze the silver necklace and sense that the creator has provided the following information:

This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.

25,000
a heavy invar necklace set with square-cut rubies Weight: <1 pound neck-worn
analyze
Analyze:
You analyze the invar necklace and sense that the creator has provided the following information:

This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.

25,000

On the small round table you see: a filigreed gold-tinted monocle, a silver squiggly-framed monocle, a rose-tinged bronze monocle and a smoke-tinted rolaren monocle.

a filigreed gold-tinted monocle Weight: <1 pound
analyze
Analyze:
You analyze the gold-tinted monocle and sense that the creator has provided the following information:

A filigreed gold-tinted monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.

USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]

Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear

Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.

1,500
a silver squiggly-framed monocle Weight: <1 pound
analyze
Analyze:
You analyze the squiggly-framed monocle and sense that the creator has provided the following information:

A silver squiggly-framed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.

USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]

Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear

Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.

1,500
a rose-tinged bronze monocle Weight: <1 pound
analyze
Analyze:
You analyze the bronze monocle and sense that the creator has provided the following information:

A rose-tinged bronze monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.

USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]

Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear

Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.

1,500
a smoke-tinted rolaren monocle Weight: <1 pound
analyze
Analyze:
You analyze the rolaren monocle and sense that the creator has provided the following information:

A smoke-tinted rolaren monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.

USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]

Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear

Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.

1,500

On the dilapidated wooden shelf you see: a sparkling white elixir, a moss green mixture, a shimmering trinket, a pearlescent purple philter, an absinthe green tincture, a pale blue-violet infusion, a dilute copper ayan'eth potion, a dilute silver ayan'eth potion, a dilute golden ayan'eth potion, a glittering ticket, a shimmering certificate, a black-eyed skull-shaped jar, a gold-leafed shimmering pink bottle, a twine-wrapped smoky grey jar, a translucent gold and teal bottle, an ivory suede-spined gold puma fur-covered ledger and a smooth turquoise leather journal embossed with a peacock feather.

a sparkling white elixir Weight: <1 pound Sanctifying boost, 1 dose
analyze
Analyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this elixir. A bard may be able to provide more specifics.
50,000
a moss green mixture Weight: <1 pound Resist Nature boost, 1 dose
analyze
Analyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this mixture. A bard may be able to provide more specifics.
25,000
a shimmering trinket Weight: <1 pound pin-worn Shimmer Trinket
examine
Examine:
A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.
5,000
a pearlescent purple philter Weight: <1 pound Ensorcelling boost, 1 dose
analyze
Analyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this philter. A bard may be able to provide more specifics.
50,000
an absinthe green tincture Weight: <1 pound Enchanting boost, 5 doses
analyze
Analyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this tincture. A bard may be able to provide more specifics.
50,000
a pale blue-violet infusion Weight: <1 pound Loresinging boost, 1 dose
analyze
Analyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this infusion. A bard may be able to provide more specifics.
10,000
a dilute copper ayan'eth potion Weight: 2 pounds Enchanting potion - 8x, 5 doses 20,000
a dilute silver ayan'eth potion Weight: 2 pounds Enchanting potion - 9x, 5 doses 25,000
a dilute golden ayan'eth potion Weight: 2 pounds Enchanting potion - 10x, 5 doses 30,000
a glittering ticket Weight: <1 pound Unlock - add 1 appearance set to an existing Shimmer Trinket
analyze, examine
Analyze:
Your ticket is used to unlock the potential of things held in your other hand.

The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).

You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.

Your ticket may not be altered or changed in any way.

Examine:
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).

3,500
a shimmering certificate Weight: <1 pound Unlock - add 1 maximum charge to an existing Shimmer Trinket
analyze, examine
Analyze:
Your certificate is used to unlock the potential of things held in your other hand.

The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.

You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.

Your certificate may not be altered or changed in any way.

Examine:
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.

1,000
a black-eyed skull-shaped jar Weight: <1 pound
Pocketed: Very small (<2-4)
one item
Alchemy jar
100 items
250
a gold-leafed shimmering pink bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one item
Alchemy jar
100 items
250
a twine-wrapped smoky grey jar Weight: <1 pound
Pocketed: Very small (<2-4)
one item
Alchemy jar
50 items
100
a translucent gold and teal bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one item
Alchemy jar
50 items
100
an ivory suede-spined gold puma fur-covered ledger Weight: <1 pound
analyze
Analyze:
This fur-covered ledger is a heavily scripted fluff book. It can be altered freely so long as it remains a book.

Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.

2,000
a smooth turquoise leather journal embossed with a peacock feather Weight: <1 pound
analyze
Analyze:
This leather journal is a heavily scripted fluff book. It can be altered freely so long as it remains a book.

Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.

2,000

Spellbound, Crevice

[Spellbound, Crevice - 26881]
Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice.
Obvious exits: north

On the dilapidated birch shelf you see: a thin shadowy black parchment, an inky black palimpsest, a small scale-shaped parchment, a silvery lightning-motif vellum, a translucent cream-hued vellum and a smooth off-white vellum.

a thin shadowy black parchment Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Tenebrous shadows slip across your alabaster skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...
Third Person: Tenebrous shadows slip across Emptora's alabaster skin as she demands divinity to heed her prayers. As if in answer, her pale blue eyes briefly blacken as she releases her fury.
Hidden or Invisible:
Specific Spell Restriction: 317
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tenebrous shadows slip across your alabaster skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...
Third Person: Tenebrous shadows slip across Emptora's alabaster skin as she demands divinity to heed her prayers. As if in answer, her pale blue eyes briefly blacken as she releases her fury.
Hidden or Invisible:
Specific Spell Restriction: 317

750
an inky black palimpsest Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this black palimpsest will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your pale blue eyes and transforms into a [Spell Name] before you...
Third Person: Flexing her fingers slightly, Emptora's form begins to darken and shadows seep from her pale blue eyes. Emptora releases her spell by transforming that darkness around her into a spiritual shield.
Hidden or Invisible: Darkness briefly pools about the area.
Specific Spell Restriction: 202
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this black palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your pale blue eyes and transforms into a [Spell Name] before you...
Third Person: Flexing her fingers slightly, Emptora's form begins to darken and shadows seep from her pale blue eyes. Emptora releases her spell by transforming that darkness around her into a spiritual shield.
Hidden or Invisible: Darkness briefly pools about the area.
Specific Spell Restriction: 202

750
a small scale-shaped parchment Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...
Third Person: Sibilantly forming the simple words of her prayer, Emptora implores shadows and darkness to protect her.
Hidden or Invisible: Sibilant prayers issue from the darkness.
Specific Spell Restriction: 303
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...
Third Person: Sibilantly forming the simple words of her prayer, Emptora implores shadows and darkness to protect her.
Hidden or Invisible: Sibilant prayers issue from the darkness.
Specific Spell Restriction: 303

750
a silvery lightning-motif vellum Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your alabaster skin as you release the stored energy of the [Spell Name] spell...
Third Person: Curling her fingers into claws, Emptora forcefully confronts the spirits and demands that they mold themselves to her will. Zorchar energy crackles across the surface of her alabaster skin as she releases the stored energy of her spell.
Hidden or Invisible: Zorchar energy crackles through the air.
Specific Spell Restriction: 125
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your alabaster skin as you release the stored energy of the [Spell Name] spell...
Third Person: Curling her fingers into claws, Emptora forcefully confronts the spirits and demands that they mold themselves to her will. Zorchar energy crackles across the surface of her alabaster skin as she releases the stored energy of her spell.
Hidden or Invisible: Zorchar energy crackles through the air.
Specific Spell Restriction: 125

750
a translucent cream-hued vellum Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your pale blue eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...
Third Person: Closing her eyes tightly, Emptora appears to be concentrating for several seconds as she murmurs a soft prayer to the spirits. As the last syllable falls from her lips, her pale blue eyes fly wide open and she flicks her fingers, releasing her spell.
Hidden or Invisible: Pale blue light suddenly flashes in the air.
Specific Spell Restriction: 116
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your pale blue eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...
Third Person: Closing her eyes tightly, Emptora appears to be concentrating for several seconds as she murmurs a soft prayer to the spirits. As the last syllable falls from her lips, her pale blue eyes fly wide open and she flicks her fingers, releasing her spell.
Hidden or Invisible: Pale blue light suddenly flashes in the air.
Specific Spell Restriction: 116

750
a smooth off-white vellum Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your pale blue eyes flash with a holy light as you release the [Spell Name] spell...
Third Person: Cajoling the lesser spirits, Emptora utters a lyrical prayer that is accompanied by simple gestures. Her pale blue eyes flash with a holy light as she releases her spell.
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.
Specific Spell Restriction: 103
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your pale blue eyes flash with a holy light as you release the [Spell Name] spell...
Third Person: Cajoling the lesser spirits, Emptora utters a lyrical prayer that is accompanied by simple gestures. Her pale blue eyes flash with a holy light as she releases her spell.
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.
Specific Spell Restriction: 103

750

On the decaying oaken slab you see: a whorl-edged cloud white note, a soft sigil-etched sheet, a violet cotton sheet, a sheet of watermarked music and a coin-edged piece of sheet music.

a whorl-edged cloud white note Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...
Third Person: Drawing her fingers through the air, Emptora's movements gradually become sluggish as she finishes the somatic components of her spell.
Hidden or Invisible:
Specific Spell Restriction: 504
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...
Third Person: Drawing her fingers through the air, Emptora's movements gradually become sluggish as she finishes the somatic components of her spell.
Hidden or Invisible:
Specific Spell Restriction: 504

750
a soft sigil-etched sheet Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Emptora invokes the elements as she casts her spell.
Hidden or Invisible:
Specific Spell Restriction: 419
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Emptora invokes the elements as she casts her spell.
Hidden or Invisible:
Specific Spell Restriction: 419

750
a violet cotton sheet Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Tracing simple lines upon your alabaster brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third pale blue eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...
Third Person: Tracing simple lines upon her alabaster brow, Emptora invokes the elements and almost instantly a third pale blue eye opens in her forehead. Seconds after she releases the spell, the eye fades away.
Hidden or Invisible:
Specific Spell Restriction: 416
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing simple lines upon your alabaster brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third pale blue eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...
Third Person: Tracing simple lines upon her alabaster brow, Emptora invokes the elements and almost instantly a third pale blue eye opens in her forehead. Seconds after she releases the spell, the eye fades away.
Hidden or Invisible:
Specific Spell Restriction: 416

750
a sheet of watermarked music Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...
Third Person: Lifting her voice in song, Emptora spins a quick tale involving a small child trying to discover the mysteries of water elementals. As she sings, she weaves her fingers in a complicated pattern that mimics the cadence of her tune and in the process, casts a spell.
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.
Specific Spell Restriction: 405
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...
Third Person: Lifting her voice in song, Emptora spins a quick tale involving a small child trying to discover the mysteries of water elementals. As she sings, she weaves her fingers in a complicated pattern that mimics the cadence of her tune and in the process, casts a spell.
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.
Specific Spell Restriction: 405

750
a coin-edged piece of sheet music Weight: <1 pound
analyze, examine, writing
Analyze:
Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.

It will provide the following phrase:

First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Emptora weaves the simple somatic components of a spell into the air.
Hidden or Invisible: Rising on the air is a familiar ditty.
Specific Spell Restriction: 403
Examine:
This paper looks interesting... perhaps you should read it.
Read:
Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Emptora weaves the simple somatic components of a spell into the air.
Hidden or Invisible: Rising on the air is a familiar ditty.
Specific Spell Restriction: 403

750