BVShop:Spellbound: Difference between revisions

The official GemStone IV encyclopedia.
Jump to navigation Jump to search
(→‎2021Q1: added additional room information)
m (Updating previous shop listing to facilitate future runs)
 
(12 intermediate revisions by 7 users not shown)
Line 1: Line 1:
==Current Shop Listing==
<!-- begin wiki output -->
<!-- Shop:Spellbound -->
{{:BVShop:Spellbound/February 2024}}
<!--__TOC__-->
==2021Q1==
<section begin=2021Q1 />


==Previous Shop Listings==
{{Festshop
{{Special:PrefixIndex/{{FULLPAGENAME}}/|stripprefix=yes|hideredirects=yes}}
|shopname=Spellbound
|look=a narrow space between two buildings<!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines-->
|location=[Map Room 3], Lich# 26877, go space
|fest=dr|year=2021|letter=S}}
===Spellbound===<!--==={{{ [Spellbound] 26878 2021-02-13 02:28:37 -0500}}}===-->
{{RoomDescription|
|roomname=Spellbound - 26878
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate.
|exits= south, out}}
{{sign|margin-right=40%|sign='''dust-covered note'''<hr><nowiki>
Items in the case are magical trinkets which automatically recharge daily:
Green Mossbark Wand: Wild Entropy (603) - 40x/day
White Ora Rod: Condemn (309) - 40x/day
Twisted Crystal Wand: Phase (704) - 40x/day
Earthen Brock Rock Trinket: Tremors (909) - 40x/day
White Eonake Cross: Remove Curse (315) - 3x/day
Golden Shield Pin: Mantle of Faith (1601) - 3x/day
Blue Quartz Pin: Mindward (1208) - 1x/day
Small Statue Clasp: Spirit Guard (1712) - 1x/day
Shiny Gold Coin Pin: Arcane Decoy (1701) - 20x/day
Green Leaf Symbol: Phoen's Strength (606) - 1x/day
Shiny Knight Symbol: Dauntless (1606) - 1x/day
Pearl-edged White Ora Cube: Benediction (307) - 1x/day
Bright Yellow Potion Trinket: Adrenal Surge (1107) - 3x/day
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity.
New potions on the shelf! The absinthe green tincture significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The pearlescent purple philter significantly increases one's ensorcelling skill and comes with 1 dose. The blue-violet infusion significantly increases one's loresong unlocking skill and comes with 1 dose. Lastly, the dilute copper ayan'eth potions (8x), dilute silver ayan'eth potions (9x), and dilute golden ayan'eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.</nowiki>}}
<blockquote>
{{Container2||container=In the sigil-incised display case you see:||contents= a blackened green mossbark wand, an elegant white ora rod, a twisted crystal wand, an earthen brown rock trinket, a gleaming white eonake cross, a dazzling golden shield pin, a blue quartz symbol, a small statue clasp, a shiny gold coin pin, a green leaf symbol, a metallic shiny knight symbol, a pearl-edged white ora cube engraved with variegated symbols and a bright yellow potion trinket.}}
{| class="wikitable col-5-right" {{prettytable}}
| a blackened green mossbark wand || Weight: <1 pound || || [[Wild Entropy]]<br>40 charges<br>persists<br>wave activated || 10,000
|-
| an elegant white ora rod || Weight: <1 pound || || [[Condemn]]<br>40 charges<br>persists<br>wave activated || 15,000
|-
| a twisted crystal wand || Weight: <1 pound || || [[Phase]]<br>40 charges<br>persists<br>wave activated || 10,000
|-
| an earthen brown rock trinket || Weight: <1 pound || pin-worn<br>functional|| [[Tremors]]<br>40 charges<br>persists<br>rub activated || 20,000
|-
| a gleaming white eonake cross || Weight: <1 pound || pin-worn<br>functional|| [[Remove Curse]]<br>3 charges<br>persists<br>rub activated || 15,000
|-
| a dazzling golden shield pin || Weight: <1 pound || pin-worn<br>functional|| [[Mantle of Faith]]<br>3 charges<br>persists<br>raise activated || 15,000
|-
| a blue quartz symbol || Weight: <1 pound || pin-worn<br>functional|| [[Mindward]]<br>1 charge<br>persists<br>raise activated || 15,000
|-
| a small statue clasp || Weight: <1 pound || pin-worn<br>functional|| [[Spirit Guard]]<br>1 charge<br>persists<br>raise activated || 20,000
|-
| a shiny gold coin pin || Weight: <1 pound || pin-worn<br>functional|| [[Arcane Decoy]]<br>20 charges<br>persists<br>rub activated || 15,000
|-
| a green leaf symbol || Weight: <1 pound || pin-worn<br>functional|| [[Phoen's Strength]]<br>1 charge<br>persists<br>raise activated || 15,000
|-
| a metallic shiny knight symbol || Weight: <1 pound || pin-worn<br>functional|| [[Dauntless]]<br>1 charge<br>persists<br>raise activated || 20,000
|-
| a pearl-edged white ora cube engraved with variegated symbols || Weight: <1 pound || pin-worn<br>functional|| [[Benediction]]<br>1 charge<br>persists<br>raise activated || 15,000
|-
| a bright yellow potion trinket || Weight: <1 pound || pin-worn<br>functional|| [[Adrenal Surge]]<br>3 charges<br>persists<br>rub activated || 15,000
|-
|}
{{Container2||container=In the rune-covered wooden crate you see:||contents= a heavy invar necklace set with square-cut rubies, a diamond-linked silver necklace dangling tiny sapphires and a twisted rose gold necklace accented with dark aquamarine rosettes.}}
{| class="wikitable col-5-right" {{prettytable}}
| a heavy invar necklace set with square-cut rubies || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-aheavyinvarnecklacesetwithsquare-cutrubies" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarnecklacesetwithsquare-cutrubies">'''Analyze:'''<br>You analyze the invar necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div>
| 25,000
|-
| a diamond-linked silver necklace dangling tiny sapphires || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-adiamond-linkedsilvernecklacedanglingtinysapphires" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adiamond-linkedsilvernecklacedanglingtinysapphires">'''Analyze:'''<br>You analyze the silver necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div>
| 25,000
|-
| a twisted rose gold necklace accented with dark aquamarine rosettes || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes">'''Analyze:'''<br>You analyze the rose gold necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br>
'''Examine:'''<br>The necklace is made from a perfect sphere of polished opal. Pearlescent light shines out in a luminous crescent from the stone, reflecting Lornon's current first half phase. A simple setting of pure platinum holds the miniature moon.
</div>
| 25,000
|-
|}
{{Container2||container=On the small round table you see:||contents= a smoke-tinted rolaren monocle, a rose-tinged bronze monocle, a silver squiggly-framed monocle and a filigreed gold-tinted monocle.}}
{| class="wikitable col-5-right" {{prettytable}}
| a smoke-tinted rolaren monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-asmoke-tintedrolarenmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoke-tintedrolarenmonocle">'''Analyze:'''<br>You analyze the rolaren monocle and sense that the creator has provided the following information:<br>
A smoke-tinted rolaren monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1,500
|-
| a rose-tinged bronze monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-arose-tingedbronzemonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-arose-tingedbronzemonocle">'''Analyze:'''<br>You analyze the bronze monocle and sense that the creator has provided the following information:<br>
A rose-tinged bronze monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1,500
|-
| a silver squiggly-framed monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-asilversquiggly-framedmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilversquiggly-framedmonocle">'''Analyze:'''<br>You analyze the squiggly-framed monocle and sense that the creator has provided the following information:<br>
A silver squiggly-framed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1,500
|-
| a filigreed gold-tinted monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-afiligreedgold-tintedmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afiligreedgold-tintedmonocle">'''Analyze:'''<br>You analyze the gold-tinted monocle and sense that the creator has provided the following information:<br>
A filigreed gold-tinted monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1,500
|-
|}
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a shimmering trinket, a smooth turquoise leather journal embossed with a peacock feather, an ivory suede-spined gold puma fur-covered ledger, a translucent gold and teal bottle, a twine-wrapped smoky grey jar, a gold-leafed shimmering pink bottle, a black-eyed skull-shaped jar, a shimmering certificate, a glittering ticket, a dilute golden ayan'eth potion, a dilute silver ayan'eth potion, a dilute copper ayan'eth potion, a pale blue-violet infusion, an absinthe green tincture and a pearlescent purple philter.}}
{| class="wikitable col-5-right" {{prettytable}}
| a shimmering trinket || Weight: <1 pound || pin-worn
| <div class="mw-customtoggle-ashimmeringtrinket" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Analyze:'''<br>The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.<br><br>It is not currently active, but is using set 1 (out of 1): nothing special at this time.<br><br>The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.<br>
'''Examine:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.
</div>
| 5,000
|-
| a smooth turquoise leather journal embossed with a peacock feather || Weight: <1 pound ||
| <div class="mw-customtoggle-asmoothturquoiseleatherjournalembossedwithapeacockfeather" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothturquoiseleatherjournalembossedwithapeacockfeather">'''Analyze:'''<br>This leather journal is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div>
| 2,000
|-
| an ivory suede-spined gold puma fur-covered ledger || Weight: <1 pound ||
| <div class="mw-customtoggle-anivorysuede-spinedgoldpumafur-coveredledger" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anivorysuede-spinedgoldpumafur-coveredledger">'''Analyze:'''<br>This fur-covered ledger is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div>
| 2,000
|-
| a translucent gold and teal bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100
|-
| a twine-wrapped smoky grey jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100
|-
| a gold-leafed shimmering pink bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250
|-
| a black-eyed skull-shaped jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250
|-
| a shimmering certificate || Weight: <1 pound ||
| <div class="mw-customtoggle-ashimmeringcertificate" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringcertificate">'''Analyze:'''<br> Your certificate is used to unlock the potential of things held in your other hand.<br><br> The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.<br><br> You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.<br><br> Your certificate may not be altered or changed in any way.<br>
'''Examine:'''<br>You glance at the shimmering certificate.<br>
You notice something written on it...<br>
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.
</div>
| 1,000
|-
| a glittering ticket || Weight: <1 pound ||
| <div class="mw-customtoggle-aglitteringticket" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br> Your ticket is used to unlock the potential of things held in your other hand.<br><br> The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br><br> You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br><br> Your ticket may not be altered or changed in any way.<br>
'''Examine:'''<br>You glance at the glittering ticket.<br>
You notice something written on it...<br>
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
</div>
| 3,500
|-
| a dilute golden ayan'eth potion || Weight: 2 pounds || || || 30,000
|-
| a dilute silver ayan'eth potion || Weight: 2 pounds || || || 25,000
|-
| a dilute copper ayan'eth potion || Weight: 2 pounds || || || 20,000
|-
| a pale blue-violet infusion || Weight: <1 pound ||
| <div class="mw-customtoggle-apaleblue-violetinfusion" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apaleblue-violetinfusion">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this infusion. A bard may be able to provide more specifics.<br></div>
| 10,000
|-
| an absinthe green tincture || Weight: <1 pound ||
| <div class="mw-customtoggle-anabsinthegreentincture" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anabsinthegreentincture">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this tincture. A bard may be able to provide more specifics.<br></div>
| 50,000
|-
| a pearlescent purple philter || Weight: <1 pound ||
| <div class="mw-customtoggle-apearlescentpurplephilter" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apearlescentpurplephilter">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this philter. A bard may be able to provide more specifics.<br></div>
| 50,000
|-
|}
</blockquote>
{{Festshop
|shopname=Spellbound
|look=a narrow space between two buildings<!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines-->
|location=[Map Room #], Lich# 26878, south
|fest=dr|year=2021|letter=S}}
===Spellbound, Crevice===<!--==={{{ [Spellbound, Crevice] 26881 2021-02-13 10:25:39 -0500}}}===-->
{{RoomDescription|
|roomname=Spellbound, Crevice - 26881
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice.
|exits= north}}
<blockquote>
{{Container2||container=On the dilapidated birch shelf you see:||contents= a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpsest and a thin shadowy black parchment.}}
{| class="wikitable col-5-right" {{prettytable}}
| a smooth off-white vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-asmoothoff-whitevellum" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothoff-whitevellum">'''Analyze:'''<br>Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your anthracite eyes flash with a holy light as you release the [Spell Name] spell...<br>
Third Person: Cajoling the lesser spirits, Maetriks utters a lyrical prayer that is accompanied by simple gestures. Her anthracite eyes flash with a holy light as she releases her spell.<br>
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.<br>
Specific Spell Restriction: 103
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a translucent cream-hued vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-atranslucentcream-huedvellum" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentcream-huedvellum">'''Analyze:'''<br>Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your anthracite eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...<br>
Third Person: Closing her eyes tightly, Maetriks appears to be concentrating for several seconds as she murmurs a soft prayer to the spirits. As the last syllable falls from her lips, her anthracite eyes fly wide open and she flicks her fingers, releasing her spell.<br>
Hidden or Invisible: Anthracite light suddenly flashes in the air.<br>
Specific Spell Restriction: 116
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a silvery lightning-motif vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-asilverylightning-motifvellum" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilverylightning-motifvellum">'''Analyze:'''<br>Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your smooth, immaculately pallid skin as you release the stored energy of the [Spell Name] spell...<br>
Third Person: Curling her fingers into claws, Maetriks forcefully confronts the spirits and demands that they mold themselves to her will. Zorchar energy crackles across the surface of her smooth, immaculately pallid skin as she releases the stored energy of her spell.<br>
Hidden or Invisible: Zorchar energy crackles through the air.<br>
Specific Spell Restriction: 125
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a small scale-shaped parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-asmallscale-shapedparchment" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallscale-shapedparchment">'''Analyze:'''<br>Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...<br>
Third Person: Sibilantly forming the simple words of her prayer, Maetriks implores shadows and darkness to protect her.<br>
Hidden or Invisible: Sibilant prayers issue from the darkness.<br>
Specific Spell Restriction: 303
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| an inky black palimpsest || Weight: <1 pound ||
| <div class="mw-customtoggle-aninkyblackpalimpsest" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aninkyblackpalimpsest">'''Analyze:'''<br>Invoking this black palimpsest will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your anthracite eyes and transforms into a [Spell Name] before you...<br>
Third Person: Flexing her fingers slightly, Maetriks's form begins to darken and shadows seep from her anthracite eyes. Maetriks releases her spell by transforming that darkness around her into a spiritual shield.<br>
Hidden or Invisible: Darkness briefly pools about the area.<br>
Specific Spell Restriction: 202
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a thin shadowy black parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-athinshadowyblackparchment" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-athinshadowyblackparchment">'''Analyze:'''<br>Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Tenebrous shadows slip across your smooth, immaculately pallid skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...<br>
Third Person: Tenebrous shadows slip across Maetriks's smooth, immaculately pallid skin as she demands divinity to heed her prayers. As if in answer, her anthracite eyes briefly blacken as she releases her fury.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 317
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
|}
{{Container2||container=On the decaying oaken slab you see:||contents= a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.}}
{| class="wikitable col-5-right" {{prettytable}}
| a coin-edged piece of sheet music || Weight: <1 pound ||
| <div class="mw-customtoggle-acoin-edgedpieceofsheetmusic" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acoin-edgedpieceofsheetmusic">'''Analyze:'''<br>Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...<br>
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Maetriks weaves the simple somatic components of a spell into the air.<br>
Hidden or Invisible: Rising on the air is a familiar ditty.<br>
Specific Spell Restriction: 403
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a sheet of watermarked music || Weight: <1 pound ||
| <div class="mw-customtoggle-asheetofwatermarkedmusic" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asheetofwatermarkedmusic">'''Analyze:'''<br>Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...<br>
Third Person: Lifting her voice in song, Maetriks spins a quick tale involving a small child trying to discover the mysteries of water elementals. As she sings, she weaves her fingers in a complicated pattern that mimics the cadence of her tune and in the process, casts a spell.<br>
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.<br>
Specific Spell Restriction: 405
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a violet cotton sheet || Weight: <1 pound ||
| <div class="mw-customtoggle-avioletcottonsheet" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-avioletcottonsheet">'''Analyze:'''<br>Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Tracing simple lines upon your smooth, immaculately pallid brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third anthracite eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...<br>
Third Person: Tracing simple lines upon her smooth, immaculately pallid brow, Maetriks invokes the elements and almost instantly a third anthracite eye opens in her forehead. Seconds after she releases the spell, the eye fades away.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 416
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a soft sigil-etched sheet || Weight: <1 pound ||
| <div class="mw-customtoggle-asoftsigil-etchedsheet" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoftsigil-etchedsheet">'''Analyze:'''<br>Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...<br>
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Maetriks invokes the elements as she casts her spell.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 419
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a whorl-edged cloud white note || Weight: <1 pound ||
| <div class="mw-customtoggle-awhorl-edgedcloudwhitenote" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awhorl-edgedcloudwhitenote">'''Analyze:'''<br>Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...<br>
Third Person: Drawing her fingers through the air, Maetriks's movements gradually become sluggish as she finishes the somatic components of her spell.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 504
<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
|}
</blockquote>
<section end=2021Q1 />
<!-- end wiki output -->


[[Category:Bloodriven Village shops|S]]
==2020Q3==
<section begin=2020Q3 />
{{Festshop
|shopname=Spellbound
|look=narrow space between two buildings
|location=[Map Room #16], Lich# 26877, go narrow space
|fest=dr|year=2020|letter=S}}
===Spellbound===<!--==={{{ [Spellbound] 26878 2020-08-14 21:03:27 -0500}}}===-->
{{RoomDescription|
|roomname=Spellbound - 26878
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a wave-painted brick door.
|exits= south, out}}
{{sign|margin-right=40%|sign='''dust-covered note'''<hr><nowiki>
Items in the case are magical trinkets which automatically recharge daily:
Gold Coin Pin: Arcane Decoy (1701) - 20x/day
Wizard Hat Symbol: Mage Armor (520) - 1x/day
Twisted Twig Trinket: Self Control (613) - 1x/day
Prismatic Clasp: Prismatic Guard (905) - 3x/day
Cloak Clasp: Cloak of Shadows (712) - 1x/day
Curved Sigil: Elemental Bias (508) - 1x/day
Square Stickpin: Prayer (313) - 1x/day
Shiny Knight Symbol: Dauntless (1606) - 1x/day
Citrine Quartz Pin: Fash'lo'nae's Gift (1750) - 1x/day
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity.
New potions on the shelf! The viscous opalescent brew significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The draught significantly increases one's ensorcelling skill and comes with 1 dose. The cordial significantly increases one's loresong unlocking skill and comes with 1 dose. Lastly, the dilute copper ayan'eth potions (8x), dilute silver ayan'eth potions (9x), and dilute golden ayan'eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.</nowiki>}}
<blockquote>
{{Container2||container=In the sigil-incised display case you see:||contents= a shiny gold coin pin, a small wizard hat symbol, a small twisted twig trinket, a smooth prismatic clasp, a dark cloak clasp, a silvery curved sigil, a white square stickpin and a metallic shiny knight symbol.}}
{| {{prettytable}}
| a shiny gold coin pin || Weight: <1 pound || pin-worn<br>functional|| [[Arcane Decoy]]<br>20 charges || 15000
|-
| a small wizard hat symbol || Weight: <1 pound || pin-worn<br>functional|| [[Mage Armor]]<br>1 charge || 20000
|-
| a small twisted twig trinket || Weight: <1 pound || pin-worn<br>functional|| [[Self Control]]<br>1 charge || 20000
|-
| a smooth prismatic clasp || Weight: <1 pound || pin-worn<br>functional|| [[Prismatic Guard]]<br>3 charges || 15000
|-
| a dark cloak clasp || Weight: <1 pound || pin-worn<br>functional|| [[Cloak of Shadows]]<br>1 charge || 20000
|-
| a silvery curved sigil || Weight: <1 pound || pin-worn<br>functional|| [[Elemental Bias]]<br>1 charge || 20000
|-
| a white square stickpin || Weight: <1 pound || pin-worn<br>functional|| [[Prayer]]<br>1 charge || 20000
|-
| a metallic shiny knight symbol || Weight: <1 pound || pin-worn<br>functional|| [[Dauntless]]<br>1 charge || 20000
|-
| a slit-pupiled citrine quartz pin || Weight: <1 pound || pin-worn<br>functional|| [[Fash'lo'nae's Gift]]<br>1 charge || 100000
|-
|}
{{Container2||container=Under the sigil-incised display case you see:||contents= a blackened silver necklace set with an orb-caged white pearl, an oval-linked electrum necklace set with a cylinder-caged crimson blazestar and a slender vaalin necklace set with a square-caged silver starstone.}}
{| {{prettytable}}
| a blackened silver necklace set with an orb-caged white pearl || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl">'''Analyze:'''<br>You analyze the silver necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div>
| 25000
|-
| an oval-linked electrum necklace set with a cylinder-caged crimson blazestar || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar">'''Analyze:'''<br>You analyze the electrum necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div>
| 25000
|-
| a slender vaalin necklace set with a square-caged silver starstone || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone">'''Analyze:'''<br>You analyze the vaalin necklace and sense that the creator has provided the following information:<br>
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div>
| 25000
|-
|}
{{Container2||container=On the small round table you see:||contents= a violet-tinted electrum monocle, a reflective gold-rimmed monocle, a bent-framed brass monocle and a heavy invar monocle.}}
{| {{prettytable}}
| a violet-tinted electrum monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-aviolet-tintedelectrummonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviolet-tintedelectrummonocle">'''Analyze:'''<br>You analyze the electrum monocle and sense that the creator has provided the following information:<br>
A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1500
|-
| a reflective gold-rimmed monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-areflectivegold-rimmedmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-areflectivegold-rimmedmonocle">'''Analyze:'''<br>You analyze the gold-rimmed monocle and sense that the creator has provided the following information:<br>
A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1500
|-
| a bent-framed brass monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-abent-framedbrassmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abent-framedbrassmonocle">'''Analyze:'''<br>You analyze the brass monocle and sense that the creator has provided the following information:<br>
A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1500
|-
| a heavy invar monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-aheavyinvarmonocle" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarmonocle">'''Analyze:'''<br>You analyze the invar monocle and sense that the creator has provided the following information:<br>
A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>
Currently, the monocle is not toggled and will be worn normally.<br>
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div>
| 1500
|-
|}
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a shimmering trinket, a dog-eared brown suede tome, an immaculate white leather codex, a bulbous vibrant crimson bottle, a gold-caged lustrous green jar, a silver-chased dark purple bottle, a squat pale pink jar, a shimmering certificate, a glittering ticket, a dilute golden ayan'eth potion, a dilute silver ayan'eth potion, a dilute copper ayan'eth potion, a foamy amber cordial, a viscous opalescent brew and a bubbling bright green draught.}}
{| {{prettytable}}
| a shimmering trinket || Weight: <1 pound || pin-worn
| <div class="mw-customtoggle-ashimmeringtrinket" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Analyze:'''<br>The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.<br><br>It is not currently active, but is using set 1 (out of 1): nothing special at this time.<br><br>The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.<br>
'''Examine:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.
</div>
| 5000
|-
| a dog-eared brown suede tome || Weight: <1 pound ||
| <div class="mw-customtoggle-adog-earedbrownsuedetome" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adog-earedbrownsuedetome">'''Analyze:'''<br>This brown suede tome is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div>
| 2000
|-
| an immaculate white leather codex || Weight: <1 pound ||
| <div class="mw-customtoggle-animmaculatewhiteleathercodex" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-animmaculatewhiteleathercodex">'''Analyze:'''<br>This white leather codex is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div>
| 2000
|-
| a bulbous vibrant crimson bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100
|-
| a gold-caged lustrous green jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100
|-
| a silver-chased dark purple bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250
|-
| a squat pale pink jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250
|-
| a shimmering certificate || Weight: <1 pound ||
| <div class="mw-customtoggle-ashimmeringcertificate" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringcertificate">'''Analyze:'''<br> Your certificate is used to unlock the potential of things held in your other hand.<br><br> The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.<br><br> You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.<br><br> Your certificate may not be altered or changed in any way.<br>
'''Examine:'''<br>As you glance over the certificate you notice something written on it...<br>
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.
</div>
| 1000
|-
| a glittering ticket || Weight: <1 pound ||
| <div class="mw-customtoggle-aglitteringticket" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br> Your ticket is used to unlock the potential of things held in your other hand.<br><br> The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br><br> You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br><br> Your ticket may not be altered or changed in any way.<br>
'''Examine:'''<br>As you glance over the ticket you notice something written on it...<br>
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
</div>
| 3500
|-
| a dilute golden ayan'eth potion || Weight: 2 pounds || || || 30000
|-
| a dilute silver ayan'eth potion || Weight: 2 pounds || || || 25000
|-
| a dilute copper ayan'eth potion || Weight: 2 pounds || || || 20000
|-
| a foamy amber cordial || Weight: <1 pound ||
| <div class="mw-customtoggle-afoamyambercordial" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afoamyambercordial">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this cordial. A bard may be able to provide more specifics.<br></div>
| 10000
|-
| a viscous opalescent brew || Weight: <1 pound ||
| <div class="mw-customtoggle-aviscousopalescentbrew" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviscousopalescentbrew">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.<br></div>
| 50000
|-
| a bubbling bright green draught || Weight: <1 pound ||
| <div class="mw-customtoggle-abubblingbrightgreendraught" role="link" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abubblingbrightgreendraught">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught. A bard may be able to provide more specifics.<br></div>
| 50000
|-
|}
</blockquote>
{{Festshop
|shopname=Spellbound
|look=<!--#shop look, the outside: e.g. pink tent with a mustache painted on the side-->
|location=[Map Room #], Lich# 26878, south
|fest=dr|year=2020|letter=S}}

===Spellbound, Crevice===<!--==={{{ [Spellbound, Crevice] 26881 2020-08-14 21:04:35 -0500}}}===-->
{{RoomDescription|
|roomname=Spellbound, Crevice - 26881
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice.
|exits= north}}
<blockquote>
{{Container2||container=On the dilapidated birch shelf you see:||contents= a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpest and a thin shadowy black parchment.}}
{| {{prettytable}}
| a smooth off-white vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-asmoothoff-whitevellum" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothoff-whitevellum">'''Analyze:'''<br>Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your umber eyes flash with a holy light as you release the [Spell Name] spell...<br>
Third Person: Cajoling the lesser spirits, Xanlin utters a lyrical prayer that is accompanied by simple gestures. His umber eyes flash with a holy light as he releases his spell.<br>
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.<br>
Specific Spell Restriction: 103<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a translucent cream-hued vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-atranslucentcream-huedvellum" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentcream-huedvellum">'''Analyze:'''<br>Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your umber eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...<br>
Third Person: Closing his eyes tightly, Xanlin appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his umber eyes fly wide open and he flicks his fingers, releasing his spell.<br>
Hidden or Invisible: Umber light suddenly flashes in the air.<br>
Specific Spell Restriction: 116<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a silvery lightning-motif vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-asilverylightning-motifvellum" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilverylightning-motifvellum">'''Analyze:'''<br>Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your sun-kissed, lightly freckled skin as you release the stored energy of the [Spell Name] spell...<br>
Third Person: Curling his fingers into claws, Xanlin forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar energy crackles across the surface of his sun-kissed, lightly freckled skin as he releases the stored energy of his spell.<br>
Hidden or Invisible: Zorchar energy crackles through the air.<br>
Specific Spell Restriction: 125<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a small scale-shaped parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-asmallscale-shapedparchment" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallscale-shapedparchment">'''Analyze:'''<br>Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...<br>
Third Person: Sibilantly forming the simple words of his prayer, Xanlin implores shadows and darkness to protect him.<br>
Hidden or Invisible: Sibilant prayers issue from the darkness.<br>
Specific Spell Restriction: 303<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| an inky black palimpest || Weight: <1 pound ||
| <div class="mw-customtoggle-aninkyblackpalimpest" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aninkyblackpalimpest">'''Analyze:'''<br>Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your umber eyes and transforms into a [Spell Name] before you...<br>
Third Person: Flexing his fingers slightly, Xanlin's form begins to darken and shadows seep from his umber eyes. Xanlin releases his spell by transforming that darkness around him into a spiritual shield.<br>
Hidden or Invisible: Darkness briefly pools about the area.<br>
Specific Spell Restriction: 202<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a thin shadowy black parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-athinshadowyblackparchment" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-athinshadowyblackparchment">'''Analyze:'''<br>Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Tenebrous shadows slip across your sun-kissed, lightly freckled skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...<br>
Third Person: Tenebrous shadows slip across Xanlin's sun-kissed, lightly freckled skin as he demands divinity to heed his prayers. As if in answer, his umber eyes briefly blacken as he releases his fury.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 317<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
|}
{{Container2||container=On the decaying oaken slab you see:||contents= a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.}}
{| {{prettytable}}
| a coin-edged piece of sheet music || Weight: <1 pound ||
| <div class="mw-customtoggle-acoin-edgedpieceofsheetmusic" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acoin-edgedpieceofsheetmusic">'''Analyze:'''<br>Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...<br>
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Xanlin weaves the simple somatic components of a spell into the air.<br>
Hidden or Invisible: Rising on the air is a familiar ditty.<br>
Specific Spell Restriction: 403<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a sheet of watermarked music || Weight: <1 pound ||
| <div class="mw-customtoggle-asheetofwatermarkedmusic" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asheetofwatermarkedmusic">'''Analyze:'''<br>Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...<br>
Third Person: Lifting his voice in song, Xanlin spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.<br>
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.<br>
Specific Spell Restriction: 405<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a violet cotton sheet || Weight: <1 pound ||
| <div class="mw-customtoggle-avioletcottonsheet" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-avioletcottonsheet">'''Analyze:'''<br>Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Tracing simple lines upon your sun-kissed, lightly freckled brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third umber eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...<br>
Third Person: Tracing simple lines upon his sun-kissed, lightly freckled brow, Xanlin invokes the elements and almost instantly a third umber eye opens in his forehead. Seconds after he releases the spell, the eye fades away.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 416<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a soft sigil-etched sheet || Weight: <1 pound ||
| <div class="mw-customtoggle-asoftsigil-etchedsheet" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoftsigil-etchedsheet">'''Analyze:'''<br>Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...<br>
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Xanlin invokes the elements as he casts his spell.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 419<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
| a whorl-edged cloud white note || Weight: <1 pound ||
| <div class="mw-customtoggle-awhorl-edgedcloudwhitenote" role="link" style="text-decoration: underline">analyze, examine</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awhorl-edgedcloudwhitenote">'''Analyze:'''<br>Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.<br>
It will provide the following phrase:<br><br>First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...<br>
Third Person: Drawing his fingers through the air, Xanlin's movements gradually become sluggish as he finishes the somatic components of his spell.<br>
Hidden or Invisible:<br>
Specific Spell Restriction: 504<br>
'''Examine:'''<br>This paper looks interesting... perhaps you should read it.
</div>
| 750
|-
|}
</blockquote>
<!-- Other Rooms Here -->
<section end=2020Q3 />

==Previous Inventory==
<section begin=current />
==Spellbound==
{{Festshop
|shopname=Spellbound
|look=a narrow space between two buildings
|location=Map Room 16, Lich #26878, go narrow space
|year=2020
|letter=S
}}
<!--==={{{ [Spellbound] 26878 2020-02-13 13:48:08 -0600}}}===-->===Spellbound===
{{RoomDescription|
|roomname=Spellbound - 26878
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate.
|exits= south, out}}
{{sign|margin-right=40%
|sign=Spell preps!
In crate: Circles 100-400
Behind brick: Circles 500-900
On brick: Circles 1000-1700, and ALL casting
Please READ each paper to see specific restrictions.
The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, a certificate to increase its maximum charges by 1, and a ticket to add 1 appearance set. Each charge lasts 1 month, and the trinket can be recharged by monks and recharging merchants.
Items in the case are magical trinkets which automatically recharge daily:
Deathstone Pin: Spirit Strike (117) - 2x/day
Heroic Knight Clasp: Heroism (215) - 1x/day
Green Leaf Symbol: Phoen's Strength (606) - 1x/day
Sickly Green Sigil: Pestilence (716) - 3x/day
Green Wavy Symbol: Mass Blur (911) - 1x/day
Yellow Smooth Cylinder: Arm of the Arkati (1605) - 1x/day
Wrapped Hand Symbol: Brace (1214) - 1x/day
Dark Purple Amethyst Pendant: Empathic Focus (1109) - 1x/day

Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity.

New potions on the shelf!
The wispy orange brew significantly increases one's enchanting skill and comes with 1 dose (old style Enchanting only!).
The viscous opalescent brew significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!).
The draught significantly increases one's ensorcelling skill and comes with 1 dose.
Lastly, the bromin (8x), aleteh (9x), and grenshol (10x) potions are for pretempering to enchant items to much higher than normal levels (8-10x).}}<blockquote>
{{Container|
|container=In the sigil-incised display case you see:}}
{| {{prettytable}}
| a black deathstone pin || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-ablackdeathstonepin" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablackdeathstonepin">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Spirit Strike]]<br>2 charges<br>rubbing activated<br>persists</div>
| 10000
|-
| a heroic knight clasp || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-aheroicknightclasp" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheroicknightclasp">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Heroism]]<br>1 charge<br>raising activated<br>persists</div>
| 20000
|-
| a green leaf symbol || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-agreenleafsymbol" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agreenleafsymbol">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Phoen's Strength]]<br>1 charge<br>raising activated<br>persists</div>
| 15000
|-
| a sickly green sigil || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-asicklygreensigil" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asicklygreensigil">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Pestilence]]<br>3 charges<br>raising activated<br>persists</div>
| 10000
|-
| a green wavy symbol || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-agreenwavysymbol" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agreenwavysymbol">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Mass Blur]]<br>1 charge<br>raising activated<br>persists</div>
| 10000
|-
| a yellow smooth cylinder || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-ayellowsmoothcylinder" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ayellowsmoothcylinder">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Arm of the Arkati]]<br>1 charge<br>raising activated<br>persists</div>
| 10000
|-
| a small wrapped hand symbol || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-asmallwrappedhandsymbol" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallwrappedhandsymbol">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Brace]]<br>1 charge<br>raising activated<br>persists</div>
| 20000
|-
| a dark purple amethyst pendant || Weight: <1 pound || pin-worn<br>functional
| <div class="mw-customtoggle-adarkpurpleamethystpendant" style="text-decoration: underline">analyze, imbed</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adarkpurpleamethystpendant">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Empathic Focus]]<br>1 charge<br>raising activated<br>persists</div>
| 100000
|-
|}
{{Container|
|container=Under the sigil-incised display case you see:}}
{| {{prettytable}}
| a blackened silver necklace set with an orb-caged white pearl || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl">'''Analyze:'''<br>This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.</div>
| 25000
|-
| an oval-linked electrum necklace set with a cylinder-caged crimson blazestar || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar">'''Analyze:'''<br>This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br><br>'''Show:'''<br>The necklace is made from a perfectly spherical star ruby. The crimson stone is a dark shade of red-black, reflecting Tilaok's current new moon phase. Even the stone's star is dim. An elegant setting of pure platinum holds the miniature moon.</div>
| 25000
|-
| a slender vaalin necklace set with a square-caged silver starstone || Weight: <1 pound || neck-worn
| <div class="mw-customtoggle-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone">'''Analyze:'''<br>This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br><br>'''Show:'''<br>The necklace is made from a perfect sphere of polished moonstone. The silvery stone is a dark shade of grey, reflecting Liabo's current new moon phase. A delicate setting of pure platinum holds the miniature moon.</div>
| 25000
|-
|}
{{Container|
|container=In the rune-covered wooden crate you see:}}
{| {{prettytable}}
| a jewel-toned striped paper || Weight: <1 pound ||
| <div class="mw-customtoggle-ajewel-tonedstripedpaper" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ajewel-tonedstripedpaper">'''Analyze:'''<br>Invoking this striped paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Grating out a request to the nearby spirits, you leech upon their power for [Spell Name], your veins light up with a dim luminescence.<br>Third Person: Grating out an incomprehensible phrase, Player's eyes flash with power, his veins lighting up with a dim luminescence.<br>Hidden or Invisible: A dim luminescence glows briefly in the shape of a figure, then disappears.<br>Specific Spell Restriction: 103<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a finely scripted palimpsest || Weight: <1 pound ||
| <div class="mw-customtoggle-afinelyscriptedpalimpsest" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afinelyscriptedpalimpsest">'''Analyze:'''<br>Invoking this scripted palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Murmuring an incantation for [Spell Name], you momentarily feel as if you are flying through the stars, darkness pressing in on you.<br>Third Person: Player's eyelids flicker rapidly and a star-pricked darkness flows across his skin as he murmurs a magical incantation.<br>Hidden or Invisible: You hear soft murmuring.<br>Specific Spell Restriction: 116<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a sun-embossed golden parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-asun-embossedgoldenparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asun-embossedgoldenparchment">'''Analyze:'''<br>Invoking this golden parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tendrils of darksome mist gather about you, swirling upwards, as you beseech the lesser spirits for aid with the [Spell Name] spell...<br>Third Person: Tendrils of darksome mist gather about Player, swirling upwards as he beseeches the lesser spirits for aid...<br>Hidden or Invisible: You hear someone beseeching the lesser spirits for aid.<br>Specific Spell Restriction: 125<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a silver-inked ebon paper || Weight: <1 pound ||
| <div class="mw-customtoggle-asilver-inkedebonpaper" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilver-inkedebonpaper">'''Analyze:'''<br>Invoking this ebon paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Motes of pearly light dance across your fingers and splay out around you as you quietly, lullingly, whisper the incantation for [Spell Name].<br>Third Person: While Player whispers quietly, lullingly, motes of pearly light dance across his fingers and splay out around him.<br>Hidden or Invisible: Motes of pearly light dance through the air as quiet, lulling whispering floats through the area.<br>Specific Spell Restriction: 202<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a creased powder blue palimpsest || Weight: <1 pound ||
| <div class="mw-customtoggle-acreasedpowderbluepalimpsest" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acreasedpowderbluepalimpsest">'''Analyze:'''<br>Invoking this powder blue palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Preparing [Spell Name], you solicit the spirits with a casual flick of the hand, and tendrils of sanguine thread appear, then wrap around your hand in an agonizingly painful bind before they fade away.<br>Third Person: Player casually flicks his hand, tendrils of sanguine thread appearing and then wrapping tightly around it before they fade away.<br>Hidden or Invisible: Tendrils of sanguine threading appear in the air, then move in an odd but clearly regular pattern before fading away.<br>Specific Spell Restriction: 214<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a heart-stamped bright salmon paper || Weight: <1 pound ||
| <div class="mw-customtoggle-aheart-stampedbrightsalmonpaper" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheart-stampedbrightsalmonpaper">'''Analyze:'''<br>Invoking this bright salmon paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you gaze off into the distance, concentrating on the thought of a simple litany for [Spell Name], gently flowing wisps of mist rise up and circle around you.<br>Third Person: Player gazes off into the distance, and gently flowing wisps of mist rise up and circle around him.<br>Hidden or Invisible: Gently flowing wisps of mist rise up and float in a circular motion.<br>Specific Spell Restriction: 303<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a midnight blue-starred parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-amidnightblue-starredparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-amidnightblue-starredparchment">'''Analyze:'''<br>Invoking this blue-starred parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Platinum energy streaks through your body, your veins and eyes glowing brightly as you growl a violent prayer for [Spell Name].<br>Third Person: Platinum energy streaks through Player's body, his veins and eyes glowing brightly as he growls a violent prayer.<br>Hidden or Invisible: Platinum energy streaks through the air in an odd pattern as a violent prayer pierces the air.<br>Specific Spell Restriction: 317<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a hideous lumpy brown scroll || Weight: <1 pound ||
| <div class="mw-customtoggle-ahideouslumpybrownscroll" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ahideouslumpybrownscroll">'''Analyze:'''<br>Invoking this lumpy brown scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you gesture precise movements for the [Spell Name] spell, your fingers transform into elongated objects before returning to their original shape...<br>Third Person: Player gestures precise movements, and for a moment, his fingers transform into elongated objects.<br>Hidden or Invisible:<br>Specific Spell Restriction: 403<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| an ale-stained half-bound scroll || Weight: <1 pound ||
| <div class="mw-customtoggle-anale-stainedhalf-boundscroll" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anale-stainedhalf-boundscroll">'''Analyze:'''<br>Invoking this half-bound scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Murmuring a soothing invocation for [Spell Name], bright arcs of elemental energy spark around you as you pull on their power.<br>Third Person: Murmuring a soothing invocation, bright arcs of elemental energy spark around Player.<br>Hidden or Invisible: Bright arcs of elemental energy spark through the air.<br>Specific Spell Restriction: 405<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a wide-striped blue and gold palimpsest || Weight: <1 pound ||
| <div class="mw-customtoggle-awide-stripedblueandgoldpalimpsest" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awide-stripedblueandgoldpalimpsest">'''Analyze:'''<br>Invoking this blue and gold palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You close your eyes and twin beams of violet light issue from your illuminated eye sockets as you invoke the powers of the elements for the [Spell Name] spell...<br>Third Person: Player closes his eyes and twin beams of violet light issue from his illuminated eye sockets as he invokes the powers of the elements.<br>Hidden or Invisible: You hear someone invoking the powers of the elements.<br>Specific Spell Restriction: 416<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| an ink-blotted coppery papyrus || Weight: <1 pound ||
| <div class="mw-customtoggle-anink-blottedcopperypapyrus" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anink-blottedcopperypapyrus">'''Analyze:'''<br>Invoking this coppery papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You draw an abstruse sigil for [Spell Name] in the air with your fingers, and brilliant light swirls up out of your pores.<br>Third Person: Player draws an abstruse sigil in the air with his fingers, and brilliant light swirls up out of his pores.<br>Hidden or Invisible: Brilliant light swirls around the area.<br>Specific Spell Restriction: 419<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
|}
{{Container|
|container=On the brick you see:}}
{| {{prettytable}}
| a frayed-edge ivory vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-afrayed-edgeivoryvellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afrayed-edgeivoryvellum">'''Analyze:'''<br>Invoking this ivory vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Breaking into a tortured song for [Spell Name], you focus on crafting a tune rife with loathing and distress.<br>Third Person: Player breaks into a tortured song, crafting a tune rife with loathing and distress.<br>Hidden or Invisible: A tortured song drifts through the area, its tune rife with loathing and distress.<br>Specific Spell Restriction: 1001<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a hastily scrawled papyrus || Weight: <1 pound ||
| <div class="mw-customtoggle-ahastilyscrawledpapyrus" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ahastilyscrawledpapyrus">'''Analyze:'''<br>Invoking this scrawled papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Drawing in a long breath to prepare [Spell Name], you eke out an off-key melody fit for shattering glass, and a sharp pain stabs your mind.<br>Third Person: Player draws in a long breath, his expression suddenly pained as he ekes out an off-key melody fit for shattering glass.<br>Hidden or Invisible: An off-key melody fit for shattering glass fills the air.<br>Specific Spell Restriction: 1019<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| an onyx-dusted pristine white palimpsest || Weight: <1 pound ||
| <div class="mw-customtoggle-anonyx-dustedpristinewhitepalimpsest" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anonyx-dustedpristinewhitepalimpsest">'''Analyze:'''<br>Invoking this pristine white palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You close your eyes and focus on [Spell Name], envPlayering how your limbs' anatomical structure -- the tendons, muscles, bones, blood vessels -- all work together in perfect harmony.<br>Third Person: Player closes his eyes, and the skin on his limbs briefly fades to translucency, the anatomical structure -- the tendons, muscles, bones, blood vessels -- visible for a mere moment.<br>Hidden or Invisible:<br>Specific Spell Restriction: 1102<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a wax-crusted pale violet scroll || Weight: <1 pound ||
| <div class="mw-customtoggle-awax-crustedpalevioletscroll" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awax-crustedpalevioletscroll">'''Analyze:'''<br>Invoking this pale violet scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you raise your hands up to prepare the [Spell Name] spell and insistently beckon several spirits to you, the faint outlines of their caliginous shadows flutter in and out of sight.<br>Third Person: The faint outlines of caliginous shadows flutter in and out of sight around Player as he raises his hands in an insistently beckoning manner.<br>Hidden or Invisible: The faint outlines of caliginous shadows flutter in and out of sight.<br>Specific Spell Restriction: 1115<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a beige flower-pressed vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-abeigeflower-pressedvellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abeigeflower-pressedvellum">'''Analyze:'''<br>Invoking this flower-pressed vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Crooning the [Spell Name] spell in an archaic tongue, you focus on the passage of time, quickly shuttering the past and the present away.<br>Third Person: As Player croons an archaic phrase, he stares off into the distance, his eyes briefly turning to pools of marbled argent.<br>Hidden or Invisible: You hear soft crooning sounds.<br>Specific Spell Restriction: 1204<br><br>'''Show:'''<br>This vellum looks interesting... perhaps you should read it.</div>
| 750
|-
| a mossy green folded parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-amossygreenfoldedparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-amossygreenfoldedparchment">'''Analyze:'''<br>Invoking this green folded parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Clearing your mind of all but the [Spell Name] spell, you touch the tips of your fingers together and focus on the single thought of terrible pain slicing outward from them.<br>Third Person: Player touches the tips of his fingers together, a cruel expression flitting across his features.<br>Hidden or Invisible:<br>Specific Spell Restriction: 1210<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a stained tart-stamped scroll || Weight: <1 pound ||
| <div class="mw-customtoggle-astainedtart-stampedscroll" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-astainedtart-stampedscroll">'''Analyze:'''<br>Invoking this tart-stamped scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Calling forth the [Spell Name] spell with the intonation of a single syllable, a murky shroud peels away from you and vanishes.<br>Third Person: As Player intones a spell with a single syllable, a murky shroud peels away from him and vanishes.<br>Hidden or Invisible: You hear a single intoned syllable.<br>Specific Spell Restriction: 1606<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| an iridescent tangerine papyrus || Weight: <1 pound ||
| <div class="mw-customtoggle-aniridescenttangerinepapyrus" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aniridescenttangerinepapyrus">'''Analyze:'''<br>Invoking this tangerine papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Waves of argentine light curl around you, embracing and seeping into you as you call upon your patron for [Spell Name].<br>Third Person: Waves of argentine light curl around Player, embracing and seeping into him as he calls upon his patron.<br>Hidden or Invisible: Waves of argentine light appear to curl through the air until they disappear.<br>Specific Spell Restriction: 1615<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| an embossed clover green vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-anembossedclovergreenvellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anembossedclovergreenvellum">'''Analyze:'''<br>Invoking this clover green vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: A haze of noxious vapor forms in the air overhead as you recite the esoteric command for [Spell Name]...<br>Third Person: A haze of noxious vapor forms in the air overhead as Player recites an esoteric command.<br>Hidden or Invisible: You hear someone reciting an esoteric command.<br>Specific Spell Restriction: 109<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a translucent alabaster vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-atranslucentalabastervellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentalabastervellum">'''Analyze:'''<br>Invoking this alabaster vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: A haze of black mist gathers around you as you prepare [Spell Name]...<br>Third Person: A haze of black mist gathers around Player as he prepares a spell...<br>Hidden or Invisible: A haze of black mist appears and slowly dissipates.<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a cat paw-printed paper || Weight: <1 pound ||
| <div class="mw-customtoggle-acatpaw-printedpaper" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acatpaw-printedpaper">'''Analyze:'''<br>Invoking this paw-printed paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Wisps of crimson light materialize in your palms, slowly floating into the air and disappearing as you chant the phrase for [Spell Name]...<br>Third Person: Wisps of crimson light materialize in Player's palms, slowly floating into the air and disappearing as he chants a phrase...<br>Hidden or Invisible: Wisps of crimson light float into the air.<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
|}
{{Container|
|container=Behind the brick you see:}}
{| {{prettytable}}
| a wavy-edged azure vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-awavy-edgedazurevellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awavy-edgedazurevellum">'''Analyze:'''<br>Invoking this azure vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Swiping your hand emphatically through the air, you deliberately slow its motion as you finish the stylized gesture for the [Spell Name] spell.<br>Third Person: Player swipes his hand emphatically through the air, his motion slowing significantly as he finishes the stylized gesture.<br>Hidden or Invisible:<br>Specific Spell Restriction: 504<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a gold-inked dark burgundy parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-agold-inkeddarkburgundyparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agold-inkeddarkburgundyparchment">'''Analyze:'''<br>Invoking this dark burgundy parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Barking an order at the ground below you to prepare the [Spell Name] spell, you feel it respond with a light tremble that sends a jolt of elemental energy racing through you.<br>Third Person: Player barks an order at the ground below him, and it trembles lightly in response.<br>Hidden or Invisible: The ground trembles lightly.<br>Specific Spell Restriction: 514<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a leaf-shaped pale green paper || Weight: <1 pound ||
| <div class="mw-customtoggle-aleaf-shapedpalegreenpaper" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aleaf-shapedpalegreenpaper">'''Analyze:'''<br>Invoking this pale green paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You envPlayer a forest growing up around you, evergreen trees bending down toward you to listen to your incantation of [Spell Name].<br>Third Person: For just a moment, Player appears to be surrounded by evergreen trees bending toward him to listen to his magical incantation.<br>Hidden or Invisible:<br>Specific Spell Restriction: 605<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a neat aquamarine papyrus || Weight: <1 pound ||
| <div class="mw-customtoggle-aneataquamarinepapyrus" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aneataquamarinepapyrus">'''Analyze:'''<br>Invoking this aquamarine papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you quickly call forth the [Spell Name] spell, variegated pale turquoise light encompasses your hands.<br>Third Person: As Player chants a magical phrase, variegated pale turquoise light encompasses his hands.<br>Hidden or Invisible: Variegated pale turquoise light briefly lights up the area.<br>Specific Spell Restriction: 619<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a simple light grey scroll || Weight: <1 pound ||
| <div class="mw-customtoggle-asimplelightgreyscroll" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asimplelightgreyscroll">'''Analyze:'''<br>Invoking this light grey scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Your body flushes with a blood red hue, your veins standing out from your skin, as you incant a mantra for [Spell Name].<br>Third Person: Player's body flushes a blood red hue, his veins standing out from his skin and twisting his features, as he incants a mantra.<br>Hidden or Invisible: You hear a quiet incantation.<br>Specific Spell Restriction: 701<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a neatily creased parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-aneatilycreasedparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aneatilycreasedparchment">'''Analyze:'''<br>Invoking this creased parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: The flesh of your fingers blackens as you breathe in deeply, blood seeping out around your knuckles, then returns to normal as you focus on preparing [Spell Name].<br>Third Person: The flesh of Player's fingers blackens, blood seeping out around his knuckles as he breathes in deeply, then returns to normal.<br>Hidden or Invisible:<br>Specific Spell Restriction: 712<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a blue-inked deep tan papyrus || Weight: <1 pound ||
| <div class="mw-customtoggle-ablue-inkeddeeptanpapyrus" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablue-inkeddeeptanpapyrus">'''Analyze:'''<br>Invoking this deep tan papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: The whites of your eyes glow a luminous green around the black depths of your pupils as you forcefully invoke [Spell Name]...<br>Third Person: The whites of Player's eyes glow a luminous green around the black depths of his pupils as he forcefully invokes a spell.<br>Hidden or Invisible: You hear someone forcefully invoking a spell.<br>Specific Spell Restriction: 713<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a ragged and stained paper || Weight: <1 pound ||
| <div class="mw-customtoggle-araggedandstainedpaper" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-araggedandstainedpaper">'''Analyze:'''<br>Invoking this stained paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Your eyes roll back into your head and your body heaves spasmodically as the invocation of the [Spell Name] spell issues from the rictus of your gaping mouth...<br>Third Person: Player's eyes roll back into his head and his body heaves spasmodically as an invocation issues from his gaping mouth.<br>Hidden or Invisible: You hear someone invoking a spell.<br>Specific Spell Restriction: 725<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a scalloped light yellow vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-ascallopedlightyellowvellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ascallopedlightyellowvellum">'''Analyze:'''<br>Invoking this light yellow vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You feel energy ripple around you in chaotic waves, and you yank it toward you as you prepare the [Spell Name] spell.<br>Third Person: Player's eyes darken, then glow with chaotically shifting light, as he chants a magical phrase.<br>Hidden or Invisible: You hear someone chant a magical phrase.<br>Specific Spell Restriction: 905<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a rolled and stamped palimpsest || Weight: <1 pound ||
| <div class="mw-customtoggle-arolledandstampedpalimpsest" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-arolledandstampedpalimpsest">'''Analyze:'''<br>Invoking this stamped palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you draw heated power from the earth for the [Spell Name] spell, bits of flesh flake off of your skin, rising up into the air and turning to brightly burning cinders that whirl around you.<br>Third Person: Bits of flesh flake off of Player's skin, rising up into the air and turning to brightly burning cinders that whirl around him.<br>Hidden or Invisible: Brightly burning cinders whirl through the air.<br>Specific Spell Restriction: 917<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a soot-dusted yellowing parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-asoot-dustedyellowingparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoot-dustedyellowingparchment">'''Analyze:'''<br>Invoking this yellowing parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: A great mass of turbulent air roils before you as you invoke the phrase for [Spell Name]...<br>Third Person: A great mass of turbulent air roils before Player as he invokes a magical phrase.<br>Hidden or Invisible: You hear someone invoking a magical phrase.<br>Specific Spell Restriction: 912<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
|}
{{Container|
|container=On the small round table you see:}}
{| {{prettytable}}
| a violet-tinted electrum monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-aviolet-tintedelectrummonocle" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviolet-tintedelectrummonocle">'''Analyze:'''<br>A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div>
| 1500
|-
| a reflective gold-rimmed monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-areflectivegold-rimmedmonocle" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-areflectivegold-rimmedmonocle">'''Analyze:'''<br>A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div>
| 1500
|-
| a bent-framed brass monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-abent-framedbrassmonocle" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abent-framedbrassmonocle">'''Analyze:'''<br>A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div>
| 1500
|-
| a heavy invar monocle || Weight: <1 pound ||
| <div class="mw-customtoggle-aheavyinvarmonocle" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarmonocle">'''Analyze:'''<br>A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div>
| 1500
|-
|}
{{Container|
|container=On the dilapidated wooden shelf you see:}}
{| {{prettytable}}
| a viscous opalescent brew || Weight: <1 pound ||
| <div class="mw-customtoggle-aviscousopalescentbrew" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviscousopalescentbrew">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.</div>
| 50000
|-
| a grenshol potion || Weight: 2 pounds || ||
| 30000
|-
| an aleteh potion || Weight: 2 pounds || ||
| 25000
|-
| a bromin potion || Weight: 2 pounds || ||
| 20000
|-
| a wispy orange brew || Weight: <1 pound ||
| <div class="mw-customtoggle-awispyorangebrew" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awispyorangebrew">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.</div>
| 50000
|-
| a shimmering trinket || Weight: <1 pound || pin-worn
| <div class="mw-customtoggle-ashimmeringtrinket" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Analyze:'''<br>The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.<br>It is not currently active, but is using set 1 (out of 1): nothing special at this time.<br>The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.<br>You can tell that the trinket is as light as it can get.<br><br>'''Show:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.</div>
| 5000
|-
| a bubbling bright green draught || Weight: <1 pound ||
| <div class="mw-customtoggle-abubblingbrightgreendraught" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abubblingbrightgreendraught">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught. A bard may be able to provide more specifics.</div>
| 50000
|-
| a dog-eared brown suede tome || Weight: <1 pound ||
| <div class="mw-customtoggle-adog-earedbrownsuedetome" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adog-earedbrownsuedetome">'''Analyze:'''<br>This brown suede tome is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>Try as you might, you cannot get a good sense of whether or not the tome's pockets could get any deeper, but you can tell that the tome is as light as it can get.</div>
| 2000
|-
| an immaculate white leather codex || Weight: <1 pound ||
| <div class="mw-customtoggle-animmaculatewhiteleathercodex" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-animmaculatewhiteleathercodex">'''Analyze:'''<br>This white leather codex is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>Try as you might, you cannot get a good sense of whether or not the codex's pockets could get any deeper, but you can tell that the codex is as light as it can get.</div>
| 2000
|-
| a bulbous vibrant crimson bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item||
| <div class="mw-customtoggle-abulbousvibrantcrimsonbottle" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abulbousvibrantcrimsonbottle">'''Analyze:'''<br>This vibrant crimson bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 50 items. PUT items in to store them. SHAKE the bottle to get them back out.</div>
| 100
|-
| a gold-caged lustrous green jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item||
| <div class="mw-customtoggle-agold-cagedlustrousgreenjar" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agold-cagedlustrousgreenjar">'''Analyze:'''<br>This lustrous green jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 50 items. PUT items in to store them. SHAKE the jar to get them back out.</div>
| 100
|-
| a silver-chased dark purple bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item||
| <div class="mw-customtoggle-asilver-chaseddarkpurplebottle" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilver-chaseddarkpurplebottle">'''Analyze:'''<br>This dark purple bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 100 items. PUT items in to store them. SHAKE the bottle to get them back out.</div>
| 250
|-
| a squat pale pink jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item||
| <div class="mw-customtoggle-asquatpalepinkjar" style="text-decoration: underline">analyze</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asquatpalepinkjar">'''Analyze:'''<br>This pale pink jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 100 items. PUT items in to store them. SHAKE the jar to get them back out.</div>
| 250
|-
| a shimmering certificate || Weight: <1 pound ||
| <div class="mw-customtoggle-ashimmeringcertificate" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringcertificate">'''Analyze:'''<br>Your certificate is used to unlock the potential of things held in your other hand.<br>The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.<br>You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.<br>Your certificate may not be altered or changed in any way.<br><br>'''Show:'''<br>As you glance over the certificate you notice something written on it...<br>This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.</div>
| 1000
|-
| a glittering ticket || Weight: <1 pound ||
| <div class="mw-customtoggle-aglitteringticket" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br>Your ticket is used to unlock the potential of things held in your other hand.<br>The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br>You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br>Your ticket may not be altered or changed in any way.<br><br>'''Show:'''<br>As you glance over the ticket you notice something written on it...<br>This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).</div>
| 3500
|-
|}
</blockquote>
<!-- additional room -->
{{Festshop
|shopname=Spellbound, Crevice
|look=crevice
|location=Lich# 26878, south
|year=2020
|letter=S
}}
<!--==={{{ [Spellbound, Crevice] 26881 2020-02-13 13:36:29 -0600}}}===-->===Spellbound, Crevice===
{{RoomDescription|
|roomname=Spellbound, Crevice - 26881
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice.
|exits= north}}
<blockquote>
{{Container|
|container=On the dilapidated birch shelf you see:}}
{| {{prettytable}}
| a smooth off-white vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-asmoothoff-whitevellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothoff-whitevellum">'''Analyze:'''<br>Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your blue-grey eyes flash with a holy light as you release the [Spell Name] spell...<br>Third Person: Cajoling the lesser spirits, Player utters a lyrical prayer that is accompanied by simple gestures. His blue-grey eyes flash with a holy light as he releases his spell.<br>Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.<br>Specific Spell Restriction: 103<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a translucent cream-hued vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-atranslucentcream-huedvellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentcream-huedvellum">'''Analyze:'''<br>Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your blue-grey eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...<br>Third Person: Closing his eyes tightly, Player appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his blue-grey eyes fly wide open and he flicks his fingers, releasing his spell.<br>Hidden or Invisible: Blue-grey light suddenly flashes in the air.<br>Specific Spell Restriction: 116<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a silvery lightning-motif vellum || Weight: <1 pound ||
| <div class="mw-customtoggle-asilverylightning-motifvellum" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilverylightning-motifvellum">'''Analyze:'''<br>Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your fair skin as you release the stored energy of the [Spell Name] spell...<br>Third Person: Curling his fingers into claws, Player forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar energy crackles across the surface of his fair skin as he releases the stored energy of his spell.<br>Hidden or Invisible: Zorchar energy crackles through the air.<br>Specific Spell Restriction: 125<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a small scale-shaped parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-asmallscale-shapedparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallscale-shapedparchment">'''Analyze:'''<br>Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...<br>Third Person: Sibilantly forming the simple words of his prayer, Player implores shadows and darkness to protect him.<br>Hidden or Invisible: Sibilant prayers issue from the darkness.<br>Specific Spell Restriction: 303<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| an inky black palimpest || Weight: <1 pound ||
| <div class="mw-customtoggle-aninkyblackpalimpest" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aninkyblackpalimpest">'''Analyze:'''<br>Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your blue-grey eyes and transforms into a [Spell Name] before you...<br>Third Person: Flexing his fingers slightly, Player's form begins to darken and shadows seep from his blue-grey eyes. Player releases his spell by transforming that darkness around him into a spiritual shield.<br>Hidden or Invisible: Darkness briefly pools about the area.<br>Specific Spell Restriction: 202<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a thin shadowy black parchment || Weight: <1 pound ||
| <div class="mw-customtoggle-athinshadowyblackparchment" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-athinshadowyblackparchment">'''Analyze:'''<br>Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tenebrous shadows slip across your fair skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vPlayer and you release your [Spell Name]...<br>Third Person: Tenebrous shadows slip across Player's fair skin as he demands divinity to heed his prayers. As if in answer, his blue-grey eyes briefly blacken as he releases his fury.<br>Hidden or Invisible:<br>Specific Spell Restriction: 317<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
|}
{{Container|
|container=On the decaying oaken slab you see:}}
{| {{prettytable}}
| a coin-edged piece of sheet music || Weight: <1 pound ||
| <div class="mw-customtoggle-acoin-edgedpieceofsheetmusic" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acoin-edgedpieceofsheetmusic">'''Analyze:'''<br>Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...<br>Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Player weaves the simple somatic components of a spell into the air.<br>Hidden or Invisible: Rising on the air is a familiar ditty.<br>Specific Spell Restriction: 403<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a sheet of watermarked music || Weight: <1 pound ||
| <div class="mw-customtoggle-asheetofwatermarkedmusic" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asheetofwatermarkedmusic">'''Analyze:'''<br>Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...<br>Third Person: Lifting his voice in song, Player spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.<br>Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.<br>Specific Spell Restriction: 405<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a violet cotton sheet || Weight: <1 pound ||
| <div class="mw-customtoggle-avioletcottonsheet" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-avioletcottonsheet">'''Analyze:'''<br>Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tracing simple lines upon your fair brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third blue-grey eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...<br>Third Person: Tracing simple lines upon his fair brow, Player invokes the elements and almost instantly a third blue-grey eye opens in his forehead. Seconds after he releases the spell, the eye fades away.<br>Hidden or Invisible:<br>Specific Spell Restriction: 416<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a soft sigil-etched sheet || Weight: <1 pound ||
| <div class="mw-customtoggle-asoftsigil-etchedsheet" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoftsigil-etchedsheet">'''Analyze:'''<br>Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...<br>Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Player invokes the elements as he casts his spell.<br>Hidden or Invisible:<br>Specific Spell Restriction: 419<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
| a whorl-edged cloud white note || Weight: <1 pound ||
| <div class="mw-customtoggle-awhorl-edgedcloudwhitenote" style="text-decoration: underline">analyze, show description</div>
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awhorl-edgedcloudwhitenote">'''Analyze:'''<br>Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...<br>Third Person: Drawing his fingers through the air, Player's movements gradually become sluggish as he finishes the somatic components of his spell.<br>Hidden or Invisible:<br>Specific Spell Restriction: 504<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div>
| 750
|-
|}
</blockquote>
<!-- Other Rooms Here -->
<section end=current />






{{#section:BVShop:Spellbound/archive|archive}}
{{top}}
[[Category: Bloodriven Village Shops|S]]

Latest revision as of 12:19, 28 February 2024

Current Shop Listing

a narrow space between two buildings, [Map Room 16], Room# 8214516, Lich# L26877, go narrow space

Spellbound

[Spellbound - 8212545]
With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a dilapidated wooden shelf, a dust-covered note, a small round table haphazardly draped with square cloths and a wave-painted brick door.
Obvious exits: south, out
a dust-covered note

In the Common language, it reads:

Items in the case are magical trinkets which automatically recharge daily.  INSPECT each one to learn which spell they cast and how many charges are available per day.

In the display case you see: a stylized blue flame clasp, a gnarled green mossbark rod, a twisted clear crystal wand, a large deep blue baton, a small luminescent baton, a small statue clasp, a red potion symbol, a shining knight pin, a sparkling white crystal wand, a shiny gold coin pin, and a blue quartz symbol.

Item Type Info Details Price
a stylized blue flame clasp magic item < 1 lb
pin-worn (functional)
It is currently imbedded with the Flaming Aura (1706) spell.
Charges Remaining: 40
Activator: Rub
It will persist after its last charge is depleted.
10,000
a gnarled green mossbark rod magic item < 1 lb
It is currently imbedded with the Sounds (607) spell.
Charges Remaining: 40
Activator: Wave
It will persist after its last charge is depleted.
10,000
a twisted clear crystal wand magic item < 1 lb
It is currently imbedded with the Interference (212) spell.
Charges Remaining: 40
Activator: Wave
It will persist after its last charge is depleted.
10,000
a large deep blue baton magic item < 1 lb
It is currently imbedded with the Spirit Warding II (107) spell.
Charges Remaining: 3
Activator: Wave
It will persist after its last charge is depleted.
20,000
a small luminescent baton magic item < 1 lb
It is currently imbedded with the Elemental Defense III (414) spell.
Charges Remaining: 3
Activator: Wave
It will persist after its last charge is depleted.
20,000
a small statue clasp magic item < 1 lb
pin-worn (functional)
It is currently imbedded with the Spirit Guard (1712) spell.
Charges Remaining: 1
Activator: Raise
It will persist after its last charge is depleted.
20,000
a red potion symbol magic item < 1 lb
pin-worn (functional)
It is currently imbedded with the Heal II (806) spell.
Charges Remaining: 5
Activator: Rub
It will persist after its last charge is depleted.
10,000
a shining knight pin magic item < 1 lb
pin-worn (functional)
It is currently imbedded with the Bravery (211) spell.
Charges Remaining: 2
Activator: Raise
It will persist after its last charge is depleted.
15,000
a sparkling white crystal wand magic item < 1 lb
It is currently imbedded with the Strength (509) spell.
Charges Remaining: 2
Activator: Wave
It will persist after its last charge is depleted.
10,000
a shiny gold coin pin magic item < 1 lb
pin-worn (functional)
It is currently imbedded with the Arcane Decoy (1701) spell.
Charges Remaining: 20
Activator: Rub
It will persist after its last charge is depleted.
15,000
a blue quartz symbol magic item < 1 lb
pin-worn (functional)
It is currently imbedded with the Mindward (1208) spell.
Charges Remaining: 1
Activator: Raise
It will persist after its last charge is depleted.
15,000

On the wooden shelf you see: a shimmering trinket, a sparkling white elixir, a moss green mixture, a pearlescent purple philter, an absinthe green tincture, a pale blue-violet infusion, a dilute copper ayan'eth potion, a dilute silver ayan'eth potion, a dilute golden ayan'eth potion, a glittering ticket, a shimmering certificate, a black-eyed skull-shaped jar, a gold-leafed shimmering pink bottle, a twine-wrapped smoky grey jar, a translucent gold and teal bottle, an ivory suede-spined gold puma fur-covered ledger, and a smooth turquoise leather journal embossed with a peacock feather.

Item Type Info Details Price
a shimmering trinket < 1 lb
pin-worn
Shimmer Trinket
Show / Analyze
Show:
A soft shimmer resonates through the the trinket, making it appear to be every color and yet no color at all.
Analyze:

Charges: 3 / 3 Available Sets: 1

5,000
a sparkling white elixir liquid < 1 lb
Profession Service Potion
Temporarily enhances sanctifying skill by 500

Quaffs Remaining: 1

50,000
a moss green mixture liquid < 1 lb
Profession Service Potion
Temporarily enhances nature resistance skill by 250

Quaffs Remaining: 1

25,000
a pearlescent purple philter liquid < 1 lb
Profession Service Potion
Temporarily enhances ensorcelling skill by 500

Quaffs Remaining: 1

50,000
an absinthe green tincture liquid < 1 lb
Profession Service Potion
Temporarily enhances enchanting skill by 500

Quaffs Remaining: 5

50,000
a pale blue-violet infusion liquid < 1 lb
Profession Service Potion
Temporarily enhances loresong unlocking skill by 500

Quaffs Remaining: 1

10,000
a dilute copper ayan'eth potion 2 lbs
Enchanting Potion

20,000
a dilute silver ayan'eth potion 2 lbs
Enchanting Potion

25,000
a dilute golden ayan'eth potion 2 lbs
Enchanting Potion

30,000
a glittering ticket unlock certificate
Shimmer Trinket
The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
3,500
a shimmering certificate unlock certificate
Shimmer Trinket
The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.
1,000
a black-eyed skull-shaped jar < 1 lb
Pocketed: A very small amount (one item) (in)
Alchemy jar
Capacity: 100 items
250
a gold-leafed shimmering pink bottle < 1 lb
Pocketed: A very small amount (one item) (in)
Alchemy jar
Capacity: 100 items
250
a twine-wrapped smoky grey jar < 1 lb
Pocketed: A very small amount (one item) (in)
Alchemy jar
Capacity: 50 items
100
a translucent gold and teal bottle < 1 lb
Pocketed: A very small amount (one item) (in)
Alchemy jar
Capacity: 50 items
100
an ivory suede-spined gold puma fur-covered ledger < 1 lb
Pocketed: A very small amount (one item) (in)
Fluff book
2,000
a smooth turquoise leather journal embossed with a peacock feather < 1 lb
Pocketed: A very small amount (one item) (in)
Fluff book
2,000

On the round table you see: a filigreed gold-tinted monocle, a silver squiggly-framed monocle, a rose-tinged bronze monocle, and a smoke-tinted rolaren monocle.

Item Type Info Details Price
a filigreed gold-tinted monocle < 1 lb
pin-worn
Deity Detect monocle

1,500
a silver squiggly-framed monocle < 1 lb
pin-worn
Deity Detect monocle

1,500
a rose-tinged bronze monocle < 1 lb
pin-worn
Deity Detect monocle

1,500
a smoke-tinted rolaren monocle < 1 lb
pin-worn
Deity Detect monocle

1,500

In the wooden crate you see: a twisted rose gold necklace accented with dark aquamarine rosettes, a diamond-linked silver necklace dangling tiny sapphires, and a heavy invar necklace set with square-cut rubies.

Item Type Info Details Price
a twisted rose gold necklace accented with dark aquamarine rosettes < 1 lb
neck-worn
MoonPhase Necklace - Lornon

5,000
a diamond-linked silver necklace dangling tiny sapphires < 1 lb
neck-worn
MoonPhase Necklace - Tilaok

5,000
a heavy invar necklace set with square-cut rubies < 1 lb
neck-worn
MoonPhase Necklace - Liabo

5,000

Spellbound, Crevice

[Spellbound, Crevice - 8212615]
Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf, a hole-riddled plank, and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice.
Obvious exits: north

On the birch shelf you see: a thin shadowy black parchment, an inky black palimpsest, a small scale-shaped parchment, a silvery lightning-motif vellum, a translucent cream-hued vellum, and a smooth off-white vellum.

Item Type Info Details Price
a thin shadowy black parchment < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Tenebrous shadows slip across your bronze skin as you demand divinity to heed your prayers.  As if in answer, a darkness falls across your vision and you release your [Spell Name]...
Third Person:  Tenebrous shadows slip across Elysani's bronze skin as she demands divinity to heed her prayers.  As if in answer, her grey-green eyes briefly blacken as she releases her fury.
Hidden or Invisible:  
Specific Spell Restriction:  317
750
an inky black palimpsest < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this black palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond.  Slowly, darkness seeps from your grey-green eyes and transforms into a [Spell Name] before you...
Third Person:  Flexing her fingers slightly, Elysani's form begins to darken and shadows seep from her grey-green eyes.  Elysani releases her spell by transforming that darkness around her into a spiritual shield.
Hidden or Invisible:  Darkness briefly pools about the area.
Specific Spell Restriction:  202
750
a small scale-shaped parchment < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...
Third Person:  Sibilantly forming the simple words of her prayer, Elysani implores shadows and darkness to protect her.
Hidden or Invisible:  Sibilant prayers issue from the darkness.
Specific Spell Restriction:  303
750
a silvery lightning-motif vellum < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will.  Zorchar energy crackles across the surface of your bronze skin as you release the stored energy of the [Spell Name] spell...
Third Person:  Curling her fingers into claws, Elysani forcefully confronts the spirits and demands that they mold themselves to her will.  Zorchar energy crackles across the surface of her bronze skin as she releases the stored energy of her spell.
Hidden or Invisible:  Zorchar energy crackles through the air.
Specific Spell Restriction:  125
750
a translucent cream-hued vellum < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits.  As the last syllable falls from your lips, your grey-green eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...
Third Person:  Closing her eyes tightly, Elysani appears to be concentrating for several seconds as she murmurs a soft prayer to the spirits.  As the last syllable falls from her lips, her grey-green eyes fly wide open and she flicks her fingers, releasing her spell.
Hidden or Invisible:  Grey-green light suddenly flashes in the air.
Specific Spell Restriction:  116
750
a smooth off-white vellum < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures.  Your grey-green eyes flash with a holy light as you release the [Spell Name] spell...
Third Person:  Cajoling the lesser spirits, Elysani utters a lyrical prayer that is accompanied by simple gestures.  Her grey-green eyes flash with a holy light as she releases her spell.
Hidden or Invisible:  From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.
Specific Spell Restriction:  103
750

On the oaken slab you see: a whorl-edged cloud white note, a soft sigil-etched sheet, a violet cotton sheet, a sheet of watermarked music, and a coin-edged piece of sheet music.

Item Type Info Details Price
a whorl-edged cloud white note < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud.  Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...
Third Person:  Drawing her fingers through the air, Elysani's movements gradually become sluggish as she finishes the somatic components of her spell.
Hidden or Invisible:  
Specific Spell Restriction:  504
750
a soft sigil-etched sheet < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...
Third Person:  Tracing sigils in the air, each briefly illuminating in various brilliant hues, Elysani invokes the elements as she casts her spell.
Hidden or Invisible:  
Specific Spell Restriction:  419
750
a violet cotton sheet < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Tracing simple lines upon your bronze brow, you invoke the elements and implore them to give you deeper insight.  Within seconds, a third grey-green eye opens in your forehead as you cast the [Spell Name] spell.  The eye fades in a matter of moments...
Third Person:  Tracing simple lines upon her bronze brow, Elysani invokes the elements and almost instantly a third grey-green eye opens in her forehead.  Seconds after she releases the spell, the eye fades away.
Hidden or Invisible:  
Specific Spell Restriction:  416
750
a sheet of watermarked music < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals.  As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...
Third Person:  Lifting her voice in song, Elysani spins a quick tale involving a small child trying to discover the mysteries of water elementals.  As she sings, she weaves her fingers in a complicated pattern that mimics the cadence of her tune and in the process, casts a spell.
Hidden or Invisible:  A simple song about a small child trying to discover the mysteries of water elementals rises on the air.
Specific Spell Restriction:  405
750
a coin-edged piece of sheet music < 1 lb
Custom Spell Prep Potion/Certificate
Analyze
Analyze:
Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:

First Person:  Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...
Third Person:  Humming a familiar ditty about a knave found on the wrong side of a door, Elysani weaves the simple somatic components of a spell into the air.
Hidden or Invisible:  Rising on the air is a familiar ditty.
Specific Spell Restriction:  403
750

On the hole-riddled plank you see: an aranthium mesh wand harness, a dark aranthium wand belt, a pure white aranthium wand harness, and an aranthium mesh wand belt.

Item Type Info Details Price
an aranthium mesh wand harness 2 lbs
Pocketed: A medium amount (a number of very small items) (in)
waist-worn (functional)
Wandolier
Analyze
Analyze:

The mesh wand harness is an endless wand harness.  It will create a nacre-flecked aranthium rod (an aranthium rod) when rubbed.
  The harness may be customized to set the wand description.
  The wand slots within it can be customized and are currently set to: fretwork veniom 
    (Examples of possible options: angled, gold filigree, graduated ring, fluted brass, braided cord, silk ribbon)
  It can create a wand every 86,400 seconds.
  The wands:
    * last for 86,400 seconds before crumbling.
    * cast the Major Fire spell when waved.
    * have 40 charges.
    * have a 15% chance to Twin Cast a spell.
    * have been infused with the power of a fire elemental and have 15% chance to flare after a successful attack.
25,000
a dark aranthium wand belt 2 lbs
Pocketed: A medium amount (a number of very small items) (in)
waist-worn (functional)
Wandolier
Analyze
Analyze:

The aranthium wand belt is an endless wand harness.  It will create an ebony-inlaid aranthium wand (an aranthium wand) when rubbed.
  The belt may be customized to set the wand description.
  The wand slots within it can be customized and are currently set to: woven flyrsilk 
    (Examples of possible options: angled, gold filigree, graduated ring, fluted brass, braided cord, silk ribbon)
  It can create a wand every 86,400 seconds.
  The wands:
    * last for 86,400 seconds before crumbling.
    * cast the Disintegrate spell when waved.
    * have 40 charges.
    * have a 15% chance to Twin Cast a spell.
    * have  infused with the power of a fire elementalhas been infused with a disintegrating substance and have 15% chance to flare after a successful attack.
25,000
a pure white aranthium wand harness 2 lbs
Pocketed: A medium amount (a number of very small items) (in)
waist-worn (functional)
Wandolier
Analyze
Analyze:

The aranthium wand harness is an endless wand harness.  It will create a flame-tipped white aranthium rod (an aranthium rod) when rubbed.
  The harness may be customized to set the wand description.
  The wand slots within it can be customized and are currently set to: fretwork white ora 
    (Examples of possible options: angled, gold filigree, graduated ring, fluted brass, braided cord, silk ribbon)
  It can create a wand every 86,400 seconds.
  The wands:
    * last for 86,400 seconds before crumbling.
    * cast the Condemn spell when waved.
    * have 40 charges.
    * have a 15% chance to Twin Cast a spell.
    * have used with the power of a fire elementalhas been infused with a disintegrating substancehas been infused with a flaming substance and have 15% chance to flare after a successful attack.
25,000
an aranthium mesh wand belt 2 lbs
Pocketed: A medium amount (a number of very small items) (in)
waist-worn (functional)
Wandolier
Analyze
Analyze:

The mesh wand belt is an endless wand harness.  It will create a tapered aranthium wand (an aranthium wand) when rubbed.
  The belt may be customized to set the wand description.
  The wand slots within it can be customized and are currently set to: faenor-bound 
    (Examples of possible options: angled, gold filigree, graduated ring, fluted brass, braided cord, silk ribbon)
  It can create a wand every 86,400 seconds.
  The wands:
    * last for 86,400 seconds before crumbling.
    * cast the Bone Shatter spell when waved.
    * have 40 charges.
    * have a 15% chance to Twin Cast a spell.
    * have  with the power of a fire elementalhas been infused with a disintegrating substancehas been infused with a flaming substancehas been infused with the power of an earth elemental and have 15% chance to flare after a successful attack.
25,000


Previous Shop Listings