BVShop:Spellbound: Difference between revisions
No edit summary |
|||
(27 intermediate revisions by 7 users not shown) | |||
Line 1: | Line 1: | ||
<!-- begin wiki output --> |
|||
{{TOC limit|3}} |
|||
<!-- Shop:Spellbound --> |
|||
==Current Inventory== |
|||
<!--__TOC__--> |
|||
<section begin=current /><includeonly> |
|||
== |
==2021Q1== |
||
<section begin=2021Q1 /> |
|||
</includeonly>'''Update: 12/20/18 <!--Due to the volume of items in one room, this shop is set up slightly different from others by setting sections for each container. The archive is located on the archive subpage--> |
|||
{{Festshop |
|||
|shopname=Spellbound |
|||
|look=a narrow space between two buildings<!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--> |
|||
|location=[Map Room 3], Lich# 26877, go narrow space |
|||
|fest=dr|year=2021|letter=S}} |
|||
===Spellbound===<!--==={{{ [Spellbound] 26878 2021-02-13 19:28:22 -0600}}}===--> |
|||
{{RoomDescription| |
|||
|roomname=Spellbound - 26878 |
|||
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. |
|||
|exits= south, out}} |
|||
{{sign|margin-right=40%|sign='''dust-covered note'''<hr><nowiki> |
|||
Items in the case are magical trinkets which automatically recharge daily: |
|||
{{Festshop| |
|||
|shopname=Spellbound |
|||
Green Mossbark Wand: Wild Entropy (603) - 40x/day |
|||
|look=a narrow space between two buildings |
|||
White Ora Rod: Condemn (309) - 40x/day |
|||
|location=Lich #26878, Room 16, go narrow space |
|||
Twisted Crystal Wand: Phase (704) - 40x/day |
|||
}} |
|||
Earthen Brock Rock Trinket: Tremors (909) - 40x/day |
|||
===Spellbound Entry=== |
|||
White Eonake Cross: Remove Curse (315) - 3x/day |
|||
{{RoomDescription |
|||
Golden Shield Pin: Mantle of Faith (1601) - 3x/day |
|||
|roomname=Spellbound |
|||
Blue Quartz Pin: Mindward (1208) - 1x/day |
|||
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a dust-covered note, a dilapidated wooden shelf with some stuff on it, a wave-painted brick door and a small round table haphazardously draped with square cloths with some stuff on it. |
|||
Small Statue Clasp: Spirit Guard (1712) - 1x/day |
|||
|exits = south, out}} |
|||
Shiny Gold Coin Pin: Arcane Decoy (1701) - 20x/day |
|||
====On Shelf==== |
|||
Green Leaf Symbol: Phoen's Strength (606) - 1x/day |
|||
{{sign|sign=The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, and a certificate to increase its maximum charges by 1. Each charge lasts for 1 month and the trinket can be recharged by monks and recharging merchants.}} |
|||
Shiny Knight Symbol: Dauntless (1606) - 1x/day |
|||
Pearl-edged White Ora Cube: Benediction (307) - 1x/day |
|||
Bright Yellow Potion Trinket: Adrenal Surge (1107) - 3x/day |
|||
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity. |
|||
New potions on the shelf! The absinthe green tincture significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The pearlescent purple philter significantly increases one's ensorcelling skill and comes with 1 dose. The blue-violet infusion significantly increases one's loresong unlocking skill and comes with 1 dose. Lastly, the dilute copper ayan'eth potions (8x), dilute silver ayan'eth potions (9x), and dilute golden ayan'eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.</nowiki>}} |
|||
<blockquote> |
<blockquote> |
||
{{Container2||container=In the sigil-incised display case you see:||contents= a blackened green mossbark wand, an elegant white ora rod, a twisted crystal wand, an earthen brown rock trinket, a gleaming white eonake cross, a dazzling golden shield pin, a blue quartz symbol, a small statue clasp, a shiny gold coin pin, a green leaf symbol, a metallic shiny knight symbol, a pearl-edged white ora cube engraved with variegated symbols and a bright yellow potion trinket.}} |
|||
{{Container| |
|||
{| class="wikitable col-5-right" {{prettytable}} |
|||
|container=On the dilapidated wooden shelf you see:}} |
|||
| a blackened green mossbark wand || Weight: <1 pound || || [[Wild Entropy]]<br>40 charges<br>persists<br>wave activated || 10,000 |
|||
{| {{prettytable|font-size:95%}} |
|||
|- |
|- |
||
| an elegant white ora rod || Weight: <1 pound || || [[Condemn]]<br>40 charges<br>persists<br>wave activated || 15,000 |
|||
| a gold-banded short glass jar || Pocketed: VSA (<2-4)<br>one item||alchemy jar, 100-count|| 250 |
|||
|- |
|- |
||
| a twisted crystal wand || Weight: <1 pound || || [[Phase]]<br>40 charges<br>persists<br>wave activated || 10,000 |
|||
| a hexagonal golden glass bottle || Pocketed: VSA (<2-4)<br>one item||alchemy jar, 100-count|| 250 |
|||
|- |
|- |
||
| an earthen brown rock trinket || Weight: <1 pound || pin-worn<br>functional|| [[Tremors]]<br>40 charges<br>persists<br>rub activated || 20,000 |
|||
| a vaalin-banded square glass jar || Pocketed: VSA (<2-4)<br>one item||alchemy jar, 50-count|| 100 |
|||
|- |
|- |
||
| a gleaming white eonake cross || Weight: <1 pound || pin-worn<br>functional|| [[Remove Curse]]<br>3 charges<br>persists<br>rub activated || 15,000 |
|||
| a silver-hued tall glass bottle || Pocketed: VSA (<2-4)<br>one item||alchemy jar, 50-count|| 100 |
|||
|- |
|- |
||
| a dazzling golden shield pin || Weight: <1 pound || pin-worn<br>functional|| [[Mantle of Faith]]<br>3 charges<br>persists<br>raise activated || 15,000 |
|||
| a gold-spined thick leather codex || ||heavily scripted book prop|| 2000 |
|||
|- |
|- |
||
| a blue quartz symbol || Weight: <1 pound || pin-worn<br>functional|| [[Mindward]]<br>1 charge<br>persists<br>raise activated || 15,000 |
|||
| an enruned leather-bound tome || ||heavily scripted book prop|| 2000 |
|||
|- |
|- |
||
| a small statue clasp || Weight: <1 pound || pin-worn<br>functional|| [[Spirit Guard]]<br>1 charge<br>persists<br>raise activated || 20,000 |
|||
| a shimmering trinket || || [[Shimmer Trinket]], 3 charges|| 5000 |
|||
|- |
|- |
||
| a shiny gold coin pin || Weight: <1 pound || pin-worn<br>functional|| [[Arcane Decoy]]<br>20 charges<br>persists<br>rub activated || 15,000 |
|||
| a shimmering certificate || ||Adds 1 maximum charge to a Shimmer Trinket|| 1000 |
|||
|- |
|- |
||
| a green leaf symbol || Weight: <1 pound || pin-worn<br>functional|| [[Phoen's Strength]]<br>1 charge<br>persists<br>raise activated || 15,000 |
|||
| a glittering ticket || ||Adds 1 appearance set to a Shimmer Trinket|| 3500 |
|||
|- |
|||
| a metallic shiny knight symbol || Weight: <1 pound || pin-worn<br>functional|| [[Dauntless]]<br>1 charge<br>persists<br>raise activated || 20,000 |
|||
|- |
|||
| a pearl-edged white ora cube engraved with variegated symbols || Weight: <1 pound || pin-worn<br>functional|| [[Benediction]]<br>1 charge<br>persists<br>raise activated || 15,000 |
|||
|- |
|||
| a bright yellow potion trinket || Weight: <1 pound || pin-worn<br>functional|| [[Adrenal Surge]]<br>3 charges<br>persists<br>rub activated || 15,000 |
|||
|- |
|- |
||
|} |
|} |
||
{{Container2||container=In the rune-covered wooden crate you see:||contents= a heavy invar necklace set with square-cut rubies, a diamond-linked silver necklace dangling tiny sapphires and a twisted rose gold necklace accented with dark aquamarine rosettes.}} |
|||
</blockquote> |
|||
{| class="wikitable col-5-right" {{prettytable}} |
|||
====On Table==== |
|||
| a heavy invar necklace set with square-cut rubies || Weight: <1 pound || neck-worn |
|||
{{sign|sign=New Edition! Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity.}} |
|||
| <div class="mw-customtoggle-aheavyinvarnecklacesetwithsquare-cutrubies" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<blockquote> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarnecklacesetwithsquare-cutrubies">'''Analyze:'''<br>You analyze the invar necklace and sense that the creator has provided the following information:<br> |
|||
{{Container| |
|||
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br> |
|||
|container=On the small round table you see:}} |
|||
'''Examine:'''<br>The necklace is made from a perfect sphere of polished moonstone. Silver light shines out in a glimmering sliver from the stone, reflecting Liabo's current waxing crescent phase. A delicate setting of pure platinum holds the miniature moon. |
|||
{| {{prettytable|font-size:95%}} |
|||
</div> |
|||
| a sterling silver monocle ||rowspan=4|{{big|'''[[Divine Monocle]]s}} ||rowspan=4| 1500 |
|||
| 25,000 |
|||
|- |
|- |
||
| a diamond-linked silver necklace dangling tiny sapphires || Weight: <1 pound || neck-worn |
|||
| a simple copper monocle |
|||
| <div class="mw-customtoggle-adiamond-linkedsilvernecklacedanglingtinysapphires" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adiamond-linkedsilvernecklacedanglingtinysapphires">'''Analyze:'''<br>You analyze the silver necklace and sense that the creator has provided the following information:<br> |
|||
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br> |
|||
'''Examine:'''<br>The necklace is made from a perfectly spherical star ruby. Crimson light shines out in a glimmering sliver from the stone, reflecting Tilaok's current waxing crescent phase. The stone's star twinkles gently, brightening and dimming. An elegant setting of pure platinum holds the miniature moon. |
|||
</div> |
|||
| 25,000 |
|||
|- |
|- |
||
| a twisted rose gold necklace accented with dark aquamarine rosettes || Weight: <1 pound || neck-worn |
|||
| a polished golden monocle |
|||
| <div class="mw-customtoggle-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atwistedrosegoldnecklaceaccentedwithdarkaquamarinerosettes">'''Analyze:'''<br>You analyze the rose gold necklace and sense that the creator has provided the following information:<br> |
|||
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br> |
|||
'''Examine:'''<br>The necklace is made from a perfect sphere of polished opal. Pearlescent light shines out in a luminous crescent from the stone, reflecting Lornon's current first half phase. A simple setting of pure platinum holds the miniature moon. |
|||
</div> |
|||
| 25,000 |
|||
|- |
|- |
||
|} |
|||
| a rose-tinted brass monocle |
|||
{{Container2||container=On the small round table you see:||contents= a smoke-tinted rolaren monocle, a rose-tinged bronze monocle, a silver squiggly-framed monocle and a filigreed gold-tinted monocle.}} |
|||
{| class="wikitable col-5-right" {{prettytable}} |
|||
| a smoke-tinted rolaren monocle || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-asmoke-tintedrolarenmonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoke-tintedrolarenmonocle">'''Analyze:'''<br>You analyze the rolaren monocle and sense that the creator has provided the following information:<br> |
|||
A smoke-tinted rolaren monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
| 1,500 |
|||
|- |
|- |
||
| a rose-tinged bronze monocle || Weight: <1 pound || |
|||
|}</blockquote> |
|||
| <div class="mw-customtoggle-arose-tingedbronzemonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
====In Case==== |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-arose-tingedbronzemonocle">'''Analyze:'''<br>You analyze the bronze monocle and sense that the creator has provided the following information:<br> |
|||
{{sign|sign= |
|||
A rose-tinged bronze monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
In crate: Circles 100-400 |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Behind brick: Circles 500-900 |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
On brick: Circles 1000-1700, and ALL casting |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
Please READ each paper to see specific restrictions. |
|||
| 1,500 |
|||
The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, a certificate to increase its maximum charges by 1, and a ticket to add 1 appearance set. Each charge lasts 1 month, and the trinket can be recharged by monks and recharging merchants. |
|||
Behind the crate are multicast wands: |
|||
Spiral crystal wand: Spirit (119), Elemental (417), and Mental Dispel (1218) - 5x/day |
|||
Dark glass rod: Force Project (1207) and Telekinesis (1206) - 20x/day |
|||
Luminescent baton: Elemental Defense I (401), II (406), and III (414) - 1x/day |
|||
Deep blue baton: Spirit Warding I (101) and II (107) - 1x/day |
|||
Items in the case are magical trinkets which automatically recharge daily: |
|||
Shining knight pin: Bravery (211) - 1x/day |
|||
Collection bowl trinket: Relieve Burden (314) - 1x/day |
|||
Gleaming disk clasp: Floating Disk (511) - 1x/day |
|||
Grasping arms stickpin - Grasp of the Grave (709) - 20x/day |
|||
Red potion symbol: Heal II (806) - 5x |
|||
Sigil-carved shield rune: Wizard's Shield (919) - 3x/day |
|||
Chunk of petrified wyrwood: Strength of Will (1119) - 1x/day |
|||
Iron shard pin: Iron Skin (1202) - 1x/day |
|||
Silver shield symbol: Faith Shield (1619) - 3x/day |
|||
Ominous cloud clasp: Death Cloud (1713) - 20x/day |
|||
Items behind the case are illusion pins. The base item (only) can be freely altered by any willing merchant. These items can also be hidden using COVER while worn. |
|||
New Edition! Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity. |
|||
}}<blockquote> |
|||
{{Container| |
|||
|container=In the sigil-incised display case you see:}} |
|||
{| {{prettytable}} |
|||
| an ominous cloud clasp||[[Death Cloud (1713)]]||pin-worn<br>functional|| 15000 |
|||
|- |
|- |
||
| a silver squiggly-framed monocle || Weight: <1 pound || |
|||
| a gleaming silver shield symbol||[[Faith Shield (1619)]]||pin-worn<br>functional|| 10000 |
|||
| <div class="mw-customtoggle-asilversquiggly-framedmonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilversquiggly-framedmonocle">'''Analyze:'''<br>You analyze the squiggly-framed monocle and sense that the creator has provided the following information:<br> |
|||
A silver squiggly-framed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
| 1,500 |
|||
|- |
|- |
||
| a filigreed gold-tinted monocle || Weight: <1 pound || |
|||
| a small iron shard pin||[[Iron Skin (1202)]]||pin-worn<br>functional|| 10000 |
|||
| <div class="mw-customtoggle-afiligreedgold-tintedmonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afiligreedgold-tintedmonocle">'''Analyze:'''<br>You analyze the gold-tinted monocle and sense that the creator has provided the following information:<br> |
|||
A filigreed gold-tinted monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
| 1,500 |
|||
|- |
|- |
||
|} |
|||
| a chunk of petrified wyrwood||[[Strength of Will (1119)]]||pin-worn<br>functional|| 15000 |
|||
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a shimmering trinket, a smooth turquoise leather journal embossed with a peacock feather, an ivory suede-spined gold puma fur-covered ledger, a translucent gold and teal bottle, a twine-wrapped smoky grey jar, a gold-leafed shimmering pink bottle, a black-eyed skull-shaped jar, a shimmering certificate, a glittering ticket, a dilute golden ayan'eth potion, a dilute silver ayan'eth potion, a dilute copper ayan'eth potion, a pale blue-violet infusion, an absinthe green tincture and a pearlescent purple philter.}} |
|||
{| class="wikitable col-5-right" {{prettytable}} |
|||
| a shimmering trinket || Weight: <1 pound || pin-worn |
|||
| <div class="mw-customtoggle-ashimmeringtrinket" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Analyze:'''<br>The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.<br><br>It is not currently active, but is using set 1 (out of 1): nothing special at this time.<br><br>The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.<br> |
|||
'''Examine:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all. |
|||
</div> |
|||
| 5,000 |
|||
|- |
|- |
||
| a smooth turquoise leather journal embossed with a peacock feather || Weight: <1 pound || |
|||
| a sigil-carved shield rune||[[Wizard's Shield (919)]]||pin-worn<br>functional|| 10000 |
|||
| <div class="mw-customtoggle-asmoothturquoiseleatherjournalembossedwithapeacockfeather" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothturquoiseleatherjournalembossedwithapeacockfeather">'''Analyze:'''<br>This leather journal is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br> |
|||
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br> |
|||
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div> |
|||
| 2,000 |
|||
|- |
|- |
||
| an ivory suede-spined gold puma fur-covered ledger || Weight: <1 pound || |
|||
| a red potion symbol||[[Heal II (806)]]||pin-worn<br>functional|| 10000 |
|||
| <div class="mw-customtoggle-anivorysuede-spinedgoldpumafur-coveredledger" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anivorysuede-spinedgoldpumafur-coveredledger">'''Analyze:'''<br>This fur-covered ledger is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br> |
|||
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br> |
|||
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div> |
|||
| 2,000 |
|||
|- |
|- |
||
| a translucent gold and teal bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100 |
|||
| a grasping arms stickpin||[[Grasp of the Grave (709)]]||pin-worn<br>functional|| 15000 |
|||
|- |
|- |
||
| a twine-wrapped smoky grey jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100 |
|||
| a gleaming disk clasp||[[Floating Disk (511)]]||pin-worn<br>functional|| 7500 |
|||
|- |
|- |
||
| a gold-leafed shimmering pink bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250 |
|||
| a golden collection bowl trinket||[[Relieve Burden (314)]]||pin-worn<br>functional|| 10000 |
|||
|- |
|- |
||
| a black-eyed skull-shaped jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250 |
|||
| a shining knight pin||[[Bravery (211)]]||pin-worn<br>functional|| 15000 |
|||
|- |
|- |
||
| a shimmering certificate || Weight: <1 pound || |
|||
|}</blockquote> |
|||
| <div class="mw-customtoggle-ashimmeringcertificate" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringcertificate">'''Analyze:'''<br> Your certificate is used to unlock the potential of things held in your other hand.<br><br> The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.<br><br> You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.<br><br> Your certificate may not be altered or changed in any way.<br> |
|||
====Under Case==== |
|||
'''Examine:'''<br>You glance at the shimmering certificate.<br> |
|||
<blockquote> |
|||
You notice something written on it...<br> |
|||
{{Container| |
|||
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket. |
|||
|container=Under the sigil-incised display case you see:}} |
|||
</div> |
|||
{| {{prettytable}} |
|||
| 1,000 |
|||
| a white gold necklace dangling a platinum-caged moonstone || rowspan=3|{{big|'''[[MoonPhase Necklace]]s}} ||rowspan=3|neck-worn|| rowspan=3|25000 |
|||
|- |
|||
| a glittering ticket || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-aglitteringticket" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br> Your ticket is used to unlock the potential of things held in your other hand.<br><br> The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br><br> You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br><br> Your ticket may not be altered or changed in any way.<br> |
|||
'''Examine:'''<br>You glance at the glittering ticket.<br> |
|||
You notice something written on it...<br> |
|||
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible). |
|||
</div> |
|||
| 3,500 |
|||
|- |
|- |
||
| a dilute golden ayan'eth potion || Weight: 2 pounds || || || 30,000 |
|||
| a silver necklace dangling a platinum-caged star ruby |
|||
|- |
|- |
||
| a dilute silver ayan'eth potion || Weight: 2 pounds || || || 25,000 |
|||
| a black steel necklace dangling a platinum-caged opal |
|||
|- |
|- |
||
| a dilute copper ayan'eth potion || Weight: 2 pounds || || || 20,000 |
|||
|}</blockquote> |
|||
|- |
|||
| a pale blue-violet infusion || Weight: <1 pound || |
|||
====Behind Case==== |
|||
| <div class="mw-customtoggle-apaleblue-violetinfusion" role="link" style="text-decoration: underline">analyze</div> |
|||
{{sign|sign=Items behind the case are illusion pins. The base item (only) can be freely altered by any willing merchant. These items can also be hidden using COVER while worn.}} |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apaleblue-violetinfusion">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this infusion. A bard may be able to provide more specifics.<br></div> |
|||
{{sign|sign=The illusion relics are as follows: |
|||
| 10,000 |
|||
|- |
|||
Steel-forged: Diagonal streaks of kohl black warpaint form a mask across his/her, the undulating design echoed along his/her forehead and chin. |
|||
| an absinthe green tincture || Weight: <1 pound || |
|||
Gold: Sharp blackened sanguine-stained spikes protrude along the exposed skin of his/her body. |
|||
| <div class="mw-customtoggle-anabsinthegreentincture" role="link" style="text-decoration: underline">analyze</div> |
|||
Bone: His/Her face is enshrouded by a flickering skeletal visage. |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anabsinthegreentincture">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this tincture. A bard may be able to provide more specifics.<br></div> |
|||
Serpentine: He/She has a fork-tongued green mist snake draped across his/her shoulders. |
|||
| 50,000 |
|||
Silver: Tiny mist-winged butterflies flutter about his/her form in a showcase of vibrant colors. |
|||
|- |
|||
Crow: An ethereal black mist crow perches upon his/her right shoulder, glancing about with shining red eyes.}} |
|||
| a pearlescent purple philter || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-apearlescentpurplephilter" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-apearlescentpurplephilter">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this philter. A bard may be able to provide more specifics.<br></div> |
|||
| 50,000 |
|||
|- |
|||
|} |
|||
</blockquote> |
|||
<!-- Other Rooms Here --> |
|||
{{Festshop |
|||
|shopname=Spellbound |
|||
|look=a narrow space between two buildings<!--#shop look, the outside: e.g. crumbling two-story stone tower overrun with vines--> |
|||
|location=[Map Room #], Lich# 26878, south |
|||
|fest=dr|year=2021|letter=S}} |
|||
===Spellbound, Crevice===<!--==={{{ [Spellbound, Crevice] 26881 2021-02-13 10:25:39 -0500}}}===--> |
|||
{{RoomDescription| |
|||
|roomname=Spellbound, Crevice - 26881 |
|||
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. |
|||
|exits= north}} |
|||
<blockquote> |
<blockquote> |
||
{{Container2||container=On the dilapidated birch shelf you see:||contents= a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpsest and a thin shadowy black parchment.}} |
|||
'''{{big|[[Illusion prop{{!}}Illusion pins]]}} |
|||
{| class="wikitable col-5-right" {{prettytable}} |
|||
| a smooth off-white vellum || Weight: <1 pound || |
|||
{{Container| |
|||
| <div class="mw-customtoggle-asmoothoff-whitevellum" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
|container=Behind the sigil-incised display case you see:}} |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothoff-whitevellum">'''Analyze:'''<br>Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.<br> |
|||
{| {{prettytable}} |
|||
It will provide the following phrase:<br><br>First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your anthracite eyes flash with a holy light as you release the [Spell Name] spell...<br> |
|||
Third Person: Cajoling the lesser spirits, Maetriks utters a lyrical prayer that is accompanied by simple gestures. Her anthracite eyes flash with a holy light as she releases her spell.<br> |
|||
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.<br> |
|||
Specific Spell Restriction: 103 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a translucent cream-hued vellum || Weight: <1 pound || |
|||
| a steel-forged relic||Diagonal streaks of kohl black warpaint form a mask across his/her, the undulating design echoed along his/her forehead and chin.||pin-worn|| 10000 |
|||
| <div class="mw-customtoggle-atranslucentcream-huedvellum" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentcream-huedvellum">'''Analyze:'''<br>Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your anthracite eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...<br> |
|||
Third Person: Closing her eyes tightly, Maetriks appears to be concentrating for several seconds as she murmurs a soft prayer to the spirits. As the last syllable falls from her lips, her anthracite eyes fly wide open and she flicks her fingers, releasing her spell.<br> |
|||
Hidden or Invisible: Anthracite light suddenly flashes in the air.<br> |
|||
Specific Spell Restriction: 116 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a silvery lightning-motif vellum || Weight: <1 pound || |
|||
| a gold-spiked relic||Sharp blackened sanguine-stained spikes protrude along the exposed skin of his/her body.||pin-worn|| 10000 |
|||
| <div class="mw-customtoggle-asilverylightning-motifvellum" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilverylightning-motifvellum">'''Analyze:'''<br>Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your smooth, immaculately pallid skin as you release the stored energy of the [Spell Name] spell...<br> |
|||
Third Person: Curling her fingers into claws, Maetriks forcefully confronts the spirits and demands that they mold themselves to her will. Zorchar energy crackles across the surface of her smooth, immaculately pallid skin as she releases the stored energy of her spell.<br> |
|||
Hidden or Invisible: Zorchar energy crackles through the air.<br> |
|||
Specific Spell Restriction: 125 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a small scale-shaped parchment || Weight: <1 pound || |
|||
| an onyx-veined bone relic cracked across the surface||His/Her face is enshrouded by a flickering skeletal visage.||pin-worn|| 10000 |
|||
| <div class="mw-customtoggle-asmallscale-shapedparchment" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallscale-shapedparchment">'''Analyze:'''<br>Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...<br> |
|||
Third Person: Sibilantly forming the simple words of her prayer, Maetriks implores shadows and darkness to protect her.<br> |
|||
Hidden or Invisible: Sibilant prayers issue from the darkness.<br> |
|||
Specific Spell Restriction: 303 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| an inky black palimpsest || Weight: <1 pound || |
|||
| a serpentine relic||He/She has a fork-tongued green mist snake draped across his/her shoulders.||pin-worn|| 10000 |
|||
| <div class="mw-customtoggle-aninkyblackpalimpsest" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aninkyblackpalimpsest">'''Analyze:'''<br>Invoking this black palimpsest will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your anthracite eyes and transforms into a [Spell Name] before you...<br> |
|||
Third Person: Flexing her fingers slightly, Maetriks's form begins to darken and shadows seep from her anthracite eyes. Maetriks releases her spell by transforming that darkness around her into a spiritual shield.<br> |
|||
Hidden or Invisible: Darkness briefly pools about the area.<br> |
|||
Specific Spell Restriction: 202 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a thin shadowy black parchment || Weight: <1 pound || |
|||
| a silver-edged relic||Tiny mist-winged butterflies flutter about his/her form in a showcase of vibrant colors.||pin-worn|| 10000 |
|||
| <div class="mw-customtoggle-athinshadowyblackparchment" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-athinshadowyblackparchment">'''Analyze:'''<br>Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Tenebrous shadows slip across your smooth, immaculately pallid skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...<br> |
|||
Third Person: Tenebrous shadows slip across Maetriks's smooth, immaculately pallid skin as she demands divinity to heed her prayers. As if in answer, her anthracite eyes briefly blacken as she releases her fury.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 317 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
| an alum crow relic||An ethereal black mist crow perches upon his/her right shoulder, glancing about with shining red eyes.||pin-worn|| 10000 |
|||
{{Container2||container=On the decaying oaken slab you see:||contents= a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.}} |
|||
{| class="wikitable col-5-right" {{prettytable}} |
|||
| a coin-edged piece of sheet music || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-acoin-edgedpieceofsheetmusic" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acoin-edgedpieceofsheetmusic">'''Analyze:'''<br>Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...<br> |
|||
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Maetriks weaves the simple somatic components of a spell into the air.<br> |
|||
Hidden or Invisible: Rising on the air is a familiar ditty.<br> |
|||
Specific Spell Restriction: 403 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a sheet of watermarked music || Weight: <1 pound || |
|||
|}</blockquote> |
|||
| <div class="mw-customtoggle-asheetofwatermarkedmusic" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asheetofwatermarkedmusic">'''Analyze:'''<br>Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.<br> |
|||
====Behind Crate==== |
|||
It will provide the following phrase:<br><br>First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...<br> |
|||
{{sign|sign=Behind the crate: Multi wand items, activated by raising, are back by popular demand! |
|||
Third Person: Lifting her voice in song, Maetriks spins a quick tale involving a small child trying to discover the mysteries of water elementals. As she sings, she weaves her fingers in a complicated pattern that mimics the cadence of her tune and in the process, casts a spell.<br> |
|||
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.<br> |
|||
Spiral crystal wand: Spirit (119), Elemental (417), and Mental Dispel (1218) - 5x/day |
|||
Specific Spell Restriction: 405 |
|||
Dark glass rod: Force Project (1207) and Telekinesis (1206) - 20x/day |
|||
<br> |
|||
Luminescent baton: Elemental Defense I (401), II (406), and III (414) - 1x/day |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
Deep blue baton: Spirit Warding I (101) and II (107) - 1x/day}} |
|||
</div> |
|||
<blockquote> |
|||
| 750 |
|||
{{Container| |
|||
|container=Behind the rune-covered wooden crate you see:}} |
|||
{| {{prettytable}} |
|||
| a long spiral crystal wand||[[Spirit Dispel (119)]]||[[Elemental Dispel (417)]]||[[Mental Dispel (1218)]]|||| 10000 |
|||
|- |
|- |
||
| a violet cotton sheet || Weight: <1 pound || |
|||
| a short dark glass rod||[[Force Project (1207)]]||[[Telekinesis (1206)]]|||||| 15000 |
|||
| <div class="mw-customtoggle-avioletcottonsheet" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-avioletcottonsheet">'''Analyze:'''<br>Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Tracing simple lines upon your smooth, immaculately pallid brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third anthracite eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...<br> |
|||
Third Person: Tracing simple lines upon her smooth, immaculately pallid brow, Maetriks invokes the elements and almost instantly a third anthracite eye opens in her forehead. Seconds after she releases the spell, the eye fades away.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 416 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a soft sigil-etched sheet || Weight: <1 pound || |
|||
| a small luminescent baton||[[Elemental Defense I (401)]]||[[Elemental Defense II (406)]]||[[Elemental Defense III (414)]]|||| 20000 |
|||
| <div class="mw-customtoggle-asoftsigil-etchedsheet" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoftsigil-etchedsheet">'''Analyze:'''<br>Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...<br> |
|||
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Maetriks invokes the elements as she casts her spell.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 419 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a whorl-edged cloud white note || Weight: <1 pound || |
|||
| a large deep blue baton||[[Spirit Warding I (101)]]||[[Spirit Warding II (107)]]|||||| 20000 |
|||
| <div class="mw-customtoggle-awhorl-edgedcloudwhitenote" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awhorl-edgedcloudwhitenote">'''Analyze:'''<br>Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...<br> |
|||
Third Person: Drawing her fingers through the air, Maetriks's movements gradually become sluggish as she finishes the somatic components of her spell.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 504 |
|||
<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
|}</blockquote> |
|||
</blockquote> |
|||
<section end=2021Q1 /> |
|||
<!-- end wiki output --> |
|||
== |
==2020Q3== |
||
<section begin=2020Q3 /> |
|||
{{sign|sign=In crate: Circles 100-400}} |
|||
{{Festshop |
|||
|shopname=Spellbound |
|||
|look=narrow space between two buildings |
|||
|location=[Map Room #16], Lich# 26877, go narrow space |
|||
|fest=dr|year=2020|letter=S}} |
|||
===Spellbound===<!--==={{{ [Spellbound] 26878 2020-08-14 21:03:27 -0500}}}===--> |
|||
{{RoomDescription| |
|||
|roomname=Spellbound - 26878 |
|||
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a wave-painted brick door. |
|||
|exits= south, out}} |
|||
{{sign|margin-right=40%|sign='''dust-covered note'''<hr><nowiki> |
|||
Items in the case are magical trinkets which automatically recharge daily: |
|||
Gold Coin Pin: Arcane Decoy (1701) - 20x/day |
|||
Wizard Hat Symbol: Mage Armor (520) - 1x/day |
|||
Twisted Twig Trinket: Self Control (613) - 1x/day |
|||
Prismatic Clasp: Prismatic Guard (905) - 3x/day |
|||
Cloak Clasp: Cloak of Shadows (712) - 1x/day |
|||
Curved Sigil: Elemental Bias (508) - 1x/day |
|||
Square Stickpin: Prayer (313) - 1x/day |
|||
Shiny Knight Symbol: Dauntless (1606) - 1x/day |
|||
Citrine Quartz Pin: Fash'lo'nae's Gift (1750) - 1x/day |
|||
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity. |
|||
New potions on the shelf! The viscous opalescent brew significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The draught significantly increases one's ensorcelling skill and comes with 1 dose. The cordial significantly increases one's loresong unlocking skill and comes with 1 dose. Lastly, the dilute copper ayan'eth potions (8x), dilute silver ayan'eth potions (9x), and dilute golden ayan'eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.</nowiki>}} |
|||
<blockquote> |
<blockquote> |
||
{{Container2||container=In the sigil-incised display case you see:||contents= a shiny gold coin pin, a small wizard hat symbol, a small twisted twig trinket, a smooth prismatic clasp, a dark cloak clasp, a silvery curved sigil, a white square stickpin and a metallic shiny knight symbol.}} |
|||
{{big|'''[[Custom spell prep{{!}}Spell preps]] all 750 BS}} |
|||
{| {{prettytable}} |
|||
| a shiny gold coin pin || Weight: <1 pound || pin-worn<br>functional|| [[Arcane Decoy]]<br>20 charges || 15000 |
|||
{{Container| |
|||
|container=In the rune-covered wooden crate you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a marigold paint-spattered papyrus || First Person: You draw an abstruse sigil for [Spell Name] in the air with your fingers, and brilliant light swirls up out of your pores.<br>Third Person: Person draws an abstruse sigil in the air with her fingers, and brilliant light swirls up out of her pores.<br>Hidden or Invisible: Brilliant light swirls around the area.<br>Specific Spell Restriction: [[419]] |
|||
|- |
|- |
||
| a small wizard hat symbol || Weight: <1 pound || pin-worn<br>functional|| [[Mage Armor]]<br>1 charge || 20000 |
|||
| a blue and jet dual-colored palimpsest || First Person: You close your eyes and twin beams of violet light issue from your illuminated eye sockets as you invoke the powers of the elements for the [Spell Name] spell...<br>Third Person: Person closes her eyes and twin beams of violet light issue from her illuminated eye sockets as she invokes the powers of the elements.<br>Hidden or Invisible: You hear someone invoking the powers of the elements.<br>Specific Spell Restriction: [[416]] |
|||
|- |
|- |
||
| a small twisted twig trinket || Weight: <1 pound || pin-worn<br>functional|| [[Self Control]]<br>1 charge || 20000 |
|||
| a long violet-inked scroll || First Person: Murmuring a soothing invocation for [Spell Name], bright arcs of elemental energy spark around you as you pull on their power.<br>Third Person: Murmuring a soothing invocation, bright arcs of elemental energy spark around Person.<br>Hidden or Invisible: Bright arcs of elemental energy spark through the air.<br>Specific Spell Restriction: [[405]] |
|||
|- |
|- |
||
| a smooth prismatic clasp || Weight: <1 pound || pin-worn<br>functional|| [[Prismatic Guard]]<br>3 charges || 15000 |
|||
| a dark orange scroll || First Person: As you gesture precise movements for the [Spell Name] spell, your fingers transform into elongated objects before returning to their original shape...<br>Third Person: Person gestures precise movements, and for a moment, her fingers transform into elongated objects.<br>Hidden or Invisible: <br>Specific Spell Restriction: [[403]] |
|||
|- |
|- |
||
| a dark cloak clasp || Weight: <1 pound || pin-worn<br>functional|| [[Cloak of Shadows]]<br>1 charge || 20000 |
|||
| an ebon-tined parchment || First Person: Platinum energy streaks through your body, your veins and eyes glowing brightly as you growl a violent prayer for [Spell Name].<br>Third Person: Platinum energy streaks through Person's body, her veins and eyes glowing brightly as she growls a violent prayer.<br>Hidden or Invisible: Platinum energy streaks through the air in an odd pattern as a violent prayer pierces the air.<br>Specific Spell Restriction: [[317]] |
|||
|- |
|- |
||
| a silvery curved sigil || Weight: <1 pound || pin-worn<br>functional|| [[Elemental Bias]]<br>1 charge || 20000 |
|||
| a wide grey-dotted paper || First Person: As you gaze off into the distance, concentrating on the thought of a simple litany for [Spell Name], gently flowing wisps of mist rise up and circle around you.<br>Third Person: Person gazes off into the distance, and gently flowing wisps of mist rise up and circle around her.<br>Hidden or Invisible: Gently flowing wisps of mist rise up and float in a circular motion.<br>Specific Spell Restriction: [[303]] |
|||
|- |
|- |
||
| a white square stickpin || Weight: <1 pound || pin-worn<br>functional|| [[Prayer]]<br>1 charge || 20000 |
|||
| a stamped and gold-inked palimpsest || First Person: Preparing [Spell Name], you solicit the spirits with a casual flick of the hand, and tendrils of sanguine thread appear, then wrap around your hand in an agonizingly painful bind before they fade away.<br>Third Person: Person casually flicks her hand, tendrils of sanguine thread appearing and then wrapping tightly around it before they fade away.<br>Hidden or Invisible: Tendrils of sanguine threading appear in the air, then move in an odd but clearly regular pattern before fading away.<br>Specific Spell Restriction: [[214]] |
|||
|- |
|- |
||
| a metallic shiny knight symbol || Weight: <1 pound || pin-worn<br>functional|| [[Dauntless]]<br>1 charge || 20000 |
|||
| a lightly curled white paper || First Person: Motes of pearly light dance across your fingers and splay out around you as you quietly, lullingly, whisper the incantation for [Spell Name].<br>Third Person: While Person whispers quietly, lullingly, motes of pearly light dance across her fingers and splay out around her.<br>Hidden or Invisible: Motes of pearly light dance through the air as quiet, lulling whispering floats through the area.<br>Specific Spell Restriction: [[202]] |
|||
|- |
|- |
||
| a slit-pupiled citrine quartz pin || Weight: <1 pound || pin-worn<br>functional|| [[Fash'lo'nae's Gift]]<br>1 charge || 100000 |
|||
| a stylized argent-swirled parchment || First Person: Tendrils of darksome mist gather about you, swirling upwards, as you beseech the lesser spirits for aid with the [Spell Name] spell...<br>Third Person: Tendrils of darksome mist gather about Person, swirling upwards as she beseeches the lesser spirits for aid...<br>Hidden or Invisible: You hear someone beseeching the lesser spirits for aid.<br>Specific Spell Restriction: [[125]] |
|||
|- |
|- |
||
|} |
|||
| lightly smudged palimpsest || First Person: Murmuring an incantation for [Spell Name], you momentarily feel as if you are flying through the stars, darkness pressing in on you.<br>Third Person: Person's eyelids flicker rapidly and a star-pricked darkness flows across her skin as she murmurs a magical incantation.<br>Hidden or Invisible: You hear soft murmuring.<br>Specific Spell Restriction: [[116]] |
|||
{{Container2||container=Under the sigil-incised display case you see:||contents= a blackened silver necklace set with an orb-caged white pearl, an oval-linked electrum necklace set with a cylinder-caged crimson blazestar and a slender vaalin necklace set with a square-caged silver starstone.}} |
|||
{| {{prettytable}} |
|||
| a blackened silver necklace set with an orb-caged white pearl || Weight: <1 pound || neck-worn |
|||
| <div class="mw-customtoggle-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl">'''Analyze:'''<br>You analyze the silver necklace and sense that the creator has provided the following information:<br> |
|||
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div> |
|||
| 25000 |
|||
|- |
|- |
||
| an oval-linked electrum necklace set with a cylinder-caged crimson blazestar || Weight: <1 pound || neck-worn |
|||
| a burnt-edged coal black paper || First Person: Grating out a request to the nearby spirits, you leech upon their power for [Spell Name], your veins light up with a dim luminescence.<br>Third Person: Grating out an incomprehensible phrase, Person's eyes flash with power, her veins lighting up with a dim luminescence.<br>Hidden or Invisible: A dim luminescence glows briefly in the shape of a figure, then disappears.<br>Specific Spell Restriction: [[103]] |
|||
| <div class="mw-customtoggle-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar">'''Analyze:'''<br>You analyze the electrum necklace and sense that the creator has provided the following information:<br> |
|||
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div> |
|||
| 25000 |
|||
|- |
|- |
||
| a slender vaalin necklace set with a square-caged silver starstone || Weight: <1 pound || neck-worn |
|||
|}</blockquote> |
|||
| <div class="mw-customtoggle-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone" role="link" style="text-decoration: underline">analyze</div> |
|||
====Behind Brick==== |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone">'''Analyze:'''<br>You analyze the vaalin necklace and sense that the creator has provided the following information:<br> |
|||
{{sign|sign=Behind brick: Circles 500-900}} |
|||
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br></div> |
|||
<blockquote> |
|||
| 25000 |
|||
{{big|'''[[Custom spell prep{{!}}Spell preps]] all 750 BS}} |
|||
{{Container| |
|||
|container=Behind the brick you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a double-thick ivory parchment || First Person: A great mass of turbulent air roils before you as you invoke the phrase for [Spell Name]...<br>Third Person: A great mass of turbulent air roils before Person as she invokes a magical phrase.<br>Hidden or Invisible: You hear someone invoking a magical phrase.<br>Specific Spell Restriction: [[912]] |
|||
|- |
|- |
||
|} |
|||
| a heavily creased palimpsest || First Person: As you draw heated power from the earth for the [Spell Name] spell, bits of flesh flake off of your skin, rising up into the air and turning to brightly burning cinders that whirl around you.<br>Third Person: Bits of flesh flake off of Person's skin, rising up into the air and turning to brightly burning cinders that whirl around her.<br>Hidden or Invisible: Brightly burning cinders whirl through the air.<br>Specific Spell Restriction: [[917]] |
|||
{{Container2||container=On the small round table you see:||contents= a violet-tinted electrum monocle, a reflective gold-rimmed monocle, a bent-framed brass monocle and a heavy invar monocle.}} |
|||
{| {{prettytable}} |
|||
| a violet-tinted electrum monocle || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-aviolet-tintedelectrummonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviolet-tintedelectrummonocle">'''Analyze:'''<br>You analyze the electrum monocle and sense that the creator has provided the following information:<br> |
|||
A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
| 1500 |
|||
|- |
|- |
||
| a reflective gold-rimmed monocle || Weight: <1 pound || |
|||
| a gilt-edged cream vellum || First Person: You feel energy ripple around you in chaotic waves, and you yank it toward you as you prepare the [Spell Name] spell.<br>Third Person: Person's eyes darken, then glow with chaotically shifting light, as she chants a magical phrase.<br>Hidden or Invisible: You hear someone chant a magical phrase.<br>Specific Spell Restriction: [[905]] |
|||
| <div class="mw-customtoggle-areflectivegold-rimmedmonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-areflectivegold-rimmedmonocle">'''Analyze:'''<br>You analyze the gold-rimmed monocle and sense that the creator has provided the following information:<br> |
|||
A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
| 1500 |
|||
|- |
|- |
||
| a bent-framed brass monocle || Weight: <1 pound || |
|||
| a thick rounded-edged paper || First Person: Your eyes roll back into your head and your body heaves spasmodically as the invocation of the [Spell Name] spell issues from the rictus of your gaping mouth...<br>Third Person: Person's eyes roll back into her head and her body heaves spasmodically as an invocation issues from her gaping mouth.<br>Hidden or Invisible: You hear someone invoking a spell.<br>Specific Spell Restriction: [[725]] |
|||
| <div class="mw-customtoggle-abent-framedbrassmonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abent-framedbrassmonocle">'''Analyze:'''<br>You analyze the brass monocle and sense that the creator has provided the following information:<br> |
|||
A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
| 1500 |
|||
|- |
|- |
||
| a heavy invar monocle || Weight: <1 pound || |
|||
| a rough deep crimson papyrus || First Person: The whites of your eyes glow a luminous green around the black depths of your pupils as you forcefully invoke [Spell Name]...<br>Third Person: The whites of Person's eyes glow a luminous green around the black depths of her pupils as she forcefully invokes a spell.<br>Hidden or Invisible: You hear someone forcefully invoking a spell.<br>Specific Spell Restriction: [[713]] |
|||
| <div class="mw-customtoggle-aheavyinvarmonocle" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarmonocle">'''Analyze:'''<br>You analyze the invar monocle and sense that the creator has provided the following information:<br> |
|||
A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br> |
|||
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br><br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br><br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br><br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br> |
|||
Currently, the monocle is not toggled and will be worn normally.<br> |
|||
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.<br></div> |
|||
| 1500 |
|||
|- |
|- |
||
|} |
|||
| a delicately calligraphed parchment || First Person: The flesh of your fingers blackens as you breathe in deeply, blood seeping out around your knuckles, then returns to normal as you focus on preparing [Spell Name].<br>Third Person: The flesh of Person's fingers blackens, blood seeping out around her knuckles as she breathes in deeply, then returns to normal.<br>Hidden or Invisible: <br>Specific Spell Restriction: [[712]] |
|||
{{Container2||container=On the dilapidated wooden shelf you see:||contents= a shimmering trinket, a dog-eared brown suede tome, an immaculate white leather codex, a bulbous vibrant crimson bottle, a gold-caged lustrous green jar, a silver-chased dark purple bottle, a squat pale pink jar, a shimmering certificate, a glittering ticket, a dilute golden ayan'eth potion, a dilute silver ayan'eth potion, a dilute copper ayan'eth potion, a foamy amber cordial, a viscous opalescent brew and a bubbling bright green draught.}} |
|||
{| {{prettytable}} |
|||
| a shimmering trinket || Weight: <1 pound || pin-worn |
|||
| <div class="mw-customtoggle-ashimmeringtrinket" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Analyze:'''<br>The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.<br><br>It is not currently active, but is using set 1 (out of 1): nothing special at this time.<br><br>The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.<br> |
|||
'''Examine:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all. |
|||
</div> |
|||
| 5000 |
|||
|- |
|- |
||
| a dog-eared brown suede tome || Weight: <1 pound || |
|||
| a velvety garnet red scroll || First Person: Your body flushes with a blood red hue, your veins standing out from your skin, as you incant a mantra for [Spell Name].<br>Third Person: Person's body flushes a blood red hue, her veins standing out from her skin and twisting her features, as she incants a mantra.<br>Hidden or Invisible: You hear a quiet incantation.<br>Specific Spell Restriction: [[701]] |
|||
| <div class="mw-customtoggle-adog-earedbrownsuedetome" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adog-earedbrownsuedetome">'''Analyze:'''<br>This brown suede tome is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br> |
|||
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br> |
|||
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div> |
|||
| 2000 |
|||
|- |
|- |
||
| an immaculate white leather codex || Weight: <1 pound || |
|||
| a neatly inked cyan papyrus || First Person: As you quickly call forth the [Spell Name] spell, variegated pale turquoise light encompasses your hands.<br>Third Person: As Person chants a magical phrase, variegated pale turquoise light encompasses her hands.<br>Hidden or Invisible: Variegated pale turquoise light briefly lights up the area.<br>Specific Spell Restriction: [[619]] |
|||
| <div class="mw-customtoggle-animmaculatewhiteleathercodex" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-animmaculatewhiteleathercodex">'''Analyze:'''<br>This white leather codex is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br> |
|||
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br> |
|||
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br></div> |
|||
| 2000 |
|||
|- |
|- |
||
| a bulbous vibrant crimson bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100 |
|||
| a forest green-stamped paper || First Person: You envision a forest growing up around you, evergreen trees bending down toward you to listen to your incantation of [Spell Name].<br>Third Person: For just a moment, Person appears to be surrounded by evergreen trees bending toward her to listen to her magical incantation.<br>Hidden or Invisible: <br>Specific Spell Restriction: [[605]] |
|||
|- |
|- |
||
| a gold-caged lustrous green jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>50 items || 100 |
|||
| a pale red embossed parchment || First Person: Barking an order at the ground below you to prepare the [Spell Name] spell, you feel it respond with a light tremble that sends a jolt of elemental energy racing through you.<br>Third Person: Person barks an order at the ground below her, and it trembles lightly in response.<br>Hidden or Invisible: The ground trembles lightly.<br>Specific Spell Restriction: [[514]] |
|||
|- |
|- |
||
| a silver-chased dark purple bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250 |
|||
| a wavy-edged azure vellum || First Person: Swiping your hand emphatically through the air, you deliberately slow its motion as you finish the stylized gesture for the [Spell Name] spell.<br>Third Person: Person swipes her hand emphatically through the air, her motion slowing significantly as she finishes the stylized gesture.<br>Hidden or Invisible: <br>Specific Spell Restriction: [[504]] |
|||
|- |
|- |
||
| a squat pale pink jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| || [[Alchemy_jar|Alchemy jar]]<br>100 items || 250 |
|||
|}</blockquote> |
|||
====On Brick==== |
|||
{{sign|sign=On brick: Circles 1000-1700, and ALL casting}} |
|||
<blockquote> |
|||
{{big|'''[[Custom spell prep{{!}}Spell preps]] all 750 BS}} |
|||
{{Container| |
|||
|container=On the brick you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a sickly pale green-hued paper || First Person: Wisps of crimson light materialize in your palms, slowly floating into the air and disappearing as you chant the phrase for [Spell Name]...<br>Third Person: Wisps of crimson light materialize in Person's palms, slowly floating into the air and disappearing as she chants a phrase...<br>Hidden or Invisible: Wisps of crimson light float into the air. |
|||
|- |
|- |
||
| a shimmering certificate || Weight: <1 pound || |
|||
| a broad lilac-outlined vellum || First Person: A haze of black mist gathers around you as you prepare [Spell Name]...<br>Third Person: A haze of black mist gathers around Person as she prepares a spell...<br>Hidden or Invisible: A haze of black mist appears and slowly dissipates. |
|||
| <div class="mw-customtoggle-ashimmeringcertificate" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringcertificate">'''Analyze:'''<br> Your certificate is used to unlock the potential of things held in your other hand.<br><br> The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.<br><br> You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.<br><br> Your certificate may not be altered or changed in any way.<br> |
|||
'''Examine:'''<br>As you glance over the certificate you notice something written on it...<br> |
|||
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket. |
|||
</div> |
|||
| 1000 |
|||
|- |
|- |
||
| a glittering ticket || Weight: <1 pound || |
|||
| an ivy-bordered painted vellum || First Person: A haze of noxious vapor forms in the air overhead as you recite the esoteric command for [Spell Name]...<br>Third Person: A haze of noxious vapor forms in the air overhead as Person recites an esoteric command.<br>Hidden or Invisible: You hear someone reciting an esoteric command.<br>Specific Spell Restriction: [[109]] |
|||
| <div class="mw-customtoggle-aglitteringticket" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br> Your ticket is used to unlock the potential of things held in your other hand.<br><br> The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br><br> You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br><br> Your ticket may not be altered or changed in any way.<br> |
|||
'''Examine:'''<br>As you glance over the ticket you notice something written on it...<br> |
|||
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible). |
|||
</div> |
|||
| 3500 |
|||
|- |
|- |
||
| a dilute golden ayan'eth potion || Weight: 2 pounds || || || 30000 |
|||
| a silver-sheened papyrus || First Person: Waves of argentine light curl around you, embracing and seeping into you as you call upon your patron for [Spell Name].<br>Third Person: Waves of argentine light curl around Person, embracing and seeping into her as she calls upon her patron.<br>Hidden or Invisible: Waves of argentine light appear curl through the air until they disappear.<br>Specific Spell Restriction: [[1615]] |
|||
|- |
|- |
||
| a dilute silver ayan'eth potion || Weight: 2 pounds || || || 25000 |
|||
| a small dagger-stamped scroll || First Person: Calling forth the [Spell Name] spell with the intonation of a single syllable, a murky shroud peels away from you and vanishes.<br>Third Person: As Person intones a spell with a single syllable, a murky shroud peels away from her and vanishes.<br>Hidden or Invisible: You hear a single intoned syllable.<br>Specific Spell Restriction: [[1606]] |
|||
|- |
|- |
||
| a dilute copper ayan'eth potion || Weight: 2 pounds || || || 20000 |
|||
| an off-white goatskin parchment || First Person: Clearing your mind of all but the [Spell Name] spell, you touch the tips of your fingers together and focus on the single thought of terrible pain slicing outward from them.<br>Third Person: Person touches the tips of her fingers together, a cruel expression flitting across her features.<br>Hidden or Invisible: <br> Specific Spell Restriction: [[1210]] |
|||
|- |
|- |
||
| a foamy amber cordial || Weight: <1 pound || |
|||
| a lightly stained vellum || First Person: Crooning the [Spell Name] spell in an archaic tongue, you focus on the passage of time, quickly shuttering the past and the present away.<br>Third Person: As Person croons an archaic phrase, she stares off into the distance, her eyes briefly turning to pools of marbled argent.<br>Hidden or Invisible: You hear soft crooning sounds.<br>Specific Spell Restriction: [[1204]] |
|||
| <div class="mw-customtoggle-afoamyambercordial" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afoamyambercordial">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this cordial. A bard may be able to provide more specifics.<br></div> |
|||
| 10000 |
|||
|- |
|- |
||
| a viscous opalescent brew || Weight: <1 pound || |
|||
| smooth cocoa-hued scroll || First Person: As you raise your hands up to prepare the [Spell Name] spell and insistently beckon several spirits to you, the faint outlines of their caliginous shadows flutter in and out of sight.<br>Third Person: The faint outlines of caliginous shadows flutter in and out of sight around Person as she raises her hands in an insistently beckoning manner.<br>Hidden or Invisible: The faint outlines of caliginous shadows flutter in and out of sight.<br>Specific Spell Restriction: [[1115]] |
|||
| <div class="mw-customtoggle-aviscousopalescentbrew" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviscousopalescentbrew">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.<br></div> |
|||
| 50000 |
|||
|- |
|- |
||
| a bubbling bright green draught || Weight: <1 pound || |
|||
| a slender ruby-dusted palimpsest || First Person: You close your eyes and focus on [Spell Name], envisioning how your limbs' anatomical structure -- the tendons, muscles, bones, blood vessels -- all work together in perfect harmony.<br>Third Person: Person closes her eyes, and the skin on her limbs briefly fades to transluscency, the anatomical structure -- the tendons, muscles, bones, blood vessels -- visible for a mere moment.<br>Hidden or Invisible: <br>Specific Spell Restriction: [[1102]] |
|||
| <div class="mw-customtoggle-abubblingbrightgreendraught" role="link" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abubblingbrightgreendraught">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught. A bard may be able to provide more specifics.<br></div> |
|||
| 50000 |
|||
|- |
|- |
||
|} |
|||
| a red and white-striped papyrus || First Person: Drawing in a long breath to prepare [Spell Name], you eke out an off-key melody fit for shattering glass, and a sharp pain stabs your mind.<br>Third Person: Person draws in a long breath, her expression suddenly pained as she ekes out an off-key melody fit for shattering glass.<br>Hidden or Invisible: An off-key melody fit for shattering glass fills the air.<br>Specific Spell Restriction: [[1019]] |
|||
</blockquote> |
|||
|- |
|||
{{Festshop |
|||
| a blue block-lettered vellum || First Person: Breaking into a tortured song for [Spell Name], you focus on crafting a tune rife with loathing and distress.<br>Third Person: Person breaks into a tortured song, crafting a tune rife with loathing and distress.<br>Hidden or Invisible: A tortured song drifts through the area, its tune rife with loathing and distress.<br>Specific Spell Restriction: [[1001]] |
|||
|shopname=Spellbound |
|||
|- |
|||
|look=<!--#shop look, the outside: e.g. pink tent with a mustache painted on the side--> |
|||
|}</blockquote> |
|||
|location=[Map Room #], Lich# 26878, south |
|||
|fest=dr|year=2020|letter=S}} |
|||
===Spellbound Crevice=== |
===Spellbound, Crevice===<!--==={{{ [Spellbound, Crevice] 26881 2020-08-14 21:04:35 -0500}}}===--> |
||
{{RoomDescription| |
{{RoomDescription| |
||
|roomname=Spellbound, Crevice |
|roomname=Spellbound, Crevice - 26881 |
||
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. |
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. |
||
|exits |
|exits= north}} |
||
====On Shelf==== |
|||
<blockquote> |
<blockquote> |
||
{{Container2||container=On the dilapidated birch shelf you see:||contents= a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpest and a thin shadowy black parchment.}} |
|||
{{big|'''[[Custom spell prep{{!}}Spell preps]] all 750 BS}} |
|||
{| {{prettytable}} |
|||
| a smooth off-white vellum || Weight: <1 pound || |
|||
{{Container| |
|||
| <div class="mw-customtoggle-asmoothoff-whitevellum" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
|container=On the birch shelf you see:}} |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothoff-whitevellum">'''Analyze:'''<br>Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.<br> |
|||
{| {{prettytable|font-size:95%}} |
|||
It will provide the following phrase:<br><br>First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your umber eyes flash with a holy light as you release the [Spell Name] spell...<br> |
|||
| a translucent cream-hued vellum || First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your [eye color] eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...<br>Third Person: Closing his eyes tightly, Person appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his [eye color] eyes fly wide open and he flicks his fingers, releasing his spell.<br>Hidden or Invisible: [Eye color] light suddenly flashes in the air.<br>Specific Spell Restriction: 116 |
|||
Third Person: Cajoling the lesser spirits, Xanlin utters a lyrical prayer that is accompanied by simple gestures. His umber eyes flash with a holy light as he releases his spell.<br> |
|||
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.<br> |
|||
Specific Spell Restriction: 103<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a translucent cream-hued vellum || Weight: <1 pound || |
|||
| a smooth off-white vellum || First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your [eye color] eyes flash with a holy light as you release the [Spell Name] spell...<br>Third Person: Cajoling the lesser spirits, Person utters a lyrical prayer that is accompanied by simple gestures. His [eye color] eyes flash with a holy light as he releases his spell.<br>Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.<br>Specific Spell Restriction: 103 |
|||
| <div class="mw-customtoggle-atranslucentcream-huedvellum" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentcream-huedvellum">'''Analyze:'''<br>Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your umber eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...<br> |
|||
Third Person: Closing his eyes tightly, Xanlin appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his umber eyes fly wide open and he flicks his fingers, releasing his spell.<br> |
|||
Hidden or Invisible: Umber light suddenly flashes in the air.<br> |
|||
Specific Spell Restriction: 116<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a silvery lightning-motif vellum || Weight: <1 pound || |
|||
| a silvery lightning-motif vellum || First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your [complexion] skin as you release the stored energy of the [Spell Name] spell...<br>Third Person: Curling his fingers into claws, Person forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar light crackles across the surface of his [complexion] skin as he releases the stored energy of his spell.<br>Hidden or Invisible: Zorchar energy crackles through the air.<br>Specific Spell Restriction: 125 |
|||
| <div class="mw-customtoggle-asilverylightning-motifvellum" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilverylightning-motifvellum">'''Analyze:'''<br>Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your sun-kissed, lightly freckled skin as you release the stored energy of the [Spell Name] spell...<br> |
|||
Third Person: Curling his fingers into claws, Xanlin forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar energy crackles across the surface of his sun-kissed, lightly freckled skin as he releases the stored energy of his spell.<br> |
|||
Hidden or Invisible: Zorchar energy crackles through the air.<br> |
|||
Specific Spell Restriction: 125<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a small scale-shaped parchment || Weight: <1 pound || |
|||
| a small scale-shaped parchment || First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...<br>Third Person: Sibilantly forming the simple words of his prayer, Person implores shadows and darkness to protect him.<br>Hidden or Invisible: Sibilant prayers issue from the darkness.<br>Specific Spell Restriction: 303 |
|||
| <div class="mw-customtoggle-asmallscale-shapedparchment" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallscale-shapedparchment">'''Analyze:'''<br>Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...<br> |
|||
Third Person: Sibilantly forming the simple words of his prayer, Xanlin implores shadows and darkness to protect him.<br> |
|||
Hidden or Invisible: Sibilant prayers issue from the darkness.<br> |
|||
Specific Spell Restriction: 303<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| an inky black palimpest || Weight: <1 pound || |
|||
| an inky black palimpest || First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your [eye color] eyes and transforms into a [Spell Name] before you...<br>Third Person: Flexing his fingers slightly, Person's form begins to darken and shadows seep from his [eye color] eyes. Person releases his spell by transforming that darkness around him into a spiritual shield.<br>Hidden or Invisible: Darkness briefly pools about the area.<br>Specific Spell Restriction: 202 |
|||
| <div class="mw-customtoggle-aninkyblackpalimpest" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aninkyblackpalimpest">'''Analyze:'''<br>Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your umber eyes and transforms into a [Spell Name] before you...<br> |
|||
Third Person: Flexing his fingers slightly, Xanlin's form begins to darken and shadows seep from his umber eyes. Xanlin releases his spell by transforming that darkness around him into a spiritual shield.<br> |
|||
Hidden or Invisible: Darkness briefly pools about the area.<br> |
|||
Specific Spell Restriction: 202<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a thin shadowy black parchment || Weight: <1 pound || |
|||
| a thin shadowy black parchment || First Person: Tenebrous shadows slip across your [complexion] skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...<br>Third Person: Tenebrous shadows slip across Person's [complexion] skin as he demands divinity to heed his prayers. As if in answer, his [eye color] eyes briefly blacken as he releases his fury.<br>Hidden or Invisible: <br>Specific Spell Restriction: 317 |
|||
| <div class="mw-customtoggle-athinshadowyblackparchment" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-athinshadowyblackparchment">'''Analyze:'''<br>Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Tenebrous shadows slip across your sun-kissed, lightly freckled skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...<br> |
|||
Third Person: Tenebrous shadows slip across Xanlin's sun-kissed, lightly freckled skin as he demands divinity to heed his prayers. As if in answer, his umber eyes briefly blacken as he releases his fury.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 317<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
|}</blockquote> |
|||
{{Container2||container=On the decaying oaken slab you see:||contents= a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.}} |
|||
{| {{prettytable}} |
|||
====On Slab==== |
|||
| a coin-edged piece of sheet music || Weight: <1 pound || |
|||
<blockquote> |
|||
| <div class="mw-customtoggle-acoin-edgedpieceofsheetmusic" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
{{big|'''[[Custom spell prep{{!}}Spell preps]] all 750 BS}} |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acoin-edgedpieceofsheetmusic">'''Analyze:'''<br>Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...<br> |
|||
{{Container| |
|||
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Xanlin weaves the simple somatic components of a spell into the air.<br> |
|||
|container=On the oaken slab you see:}} |
|||
Hidden or Invisible: Rising on the air is a familiar ditty.<br> |
|||
{| {{prettytable|font-size:95%}} |
|||
Specific Spell Restriction: 403<br> |
|||
| a coin-edged piece of sheet music || First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...<br>Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Person weaves the simple somatic components of a spell into the air.<br>Hidden or Invisible: Rising on the air is a familiar ditty.<br>Specific Spell Restriction: 403 |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a sheet of watermarked music || Weight: <1 pound || |
|||
| a sheet of watermarked music || First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...<br>Third Person: Lifting his voice in song, Person spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.<br>Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.<br>Specific Spell Restriction: 405 |
|||
| <div class="mw-customtoggle-asheetofwatermarkedmusic" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asheetofwatermarkedmusic">'''Analyze:'''<br>Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...<br> |
|||
Third Person: Lifting his voice in song, Xanlin spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.<br> |
|||
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.<br> |
|||
Specific Spell Restriction: 405<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a violet cotton sheet || Weight: <1 pound || |
|||
| a violet cotton sheet || First Person: Tracing simple lines upon your [complexion] brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third [eye color] eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...<br>Third Person: Tracing simple lines upon his [complexion] brow, Person invokes the elements and almost instantly a third [eye color] eye opens in his forehead. Seconds after he releases the spell, the eye fades away.<br>Hidden or Invisible: <br>Specific Spell Restriction: 416 |
|||
| <div class="mw-customtoggle-avioletcottonsheet" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-avioletcottonsheet">'''Analyze:'''<br>Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Tracing simple lines upon your sun-kissed, lightly freckled brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third umber eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...<br> |
|||
Third Person: Tracing simple lines upon his sun-kissed, lightly freckled brow, Xanlin invokes the elements and almost instantly a third umber eye opens in his forehead. Seconds after he releases the spell, the eye fades away.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 416<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a soft sigil-etched sheet || Weight: <1 pound || |
|||
| a soft sigil-etched sheet || First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...<br>Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Person invokes the elements as he casts his spell.<br>Hidden or Invisible: <br>Specific Spell Restriction: 419 |
|||
| <div class="mw-customtoggle-asoftsigil-etchedsheet" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoftsigil-etchedsheet">'''Analyze:'''<br>Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...<br> |
|||
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Xanlin invokes the elements as he casts his spell.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 419<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
| a whorl-edged cloud white note || Weight: <1 pound || |
|||
| a whorl-edged cloud white note || First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...<br>Third Person: Drawing his fingers through the air, Person's movements gradually become sluggish as he finishes the somatic components of his spell.<br>Hidden or Invisible: <br>Specific Spell Restriction: 504 |
|||
| <div class="mw-customtoggle-awhorl-edgedcloudwhitenote" role="link" style="text-decoration: underline">analyze, examine</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awhorl-edgedcloudwhitenote">'''Analyze:'''<br>Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.<br> |
|||
It will provide the following phrase:<br><br>First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...<br> |
|||
Third Person: Drawing his fingers through the air, Xanlin's movements gradually become sluggish as he finishes the somatic components of his spell.<br> |
|||
Hidden or Invisible:<br> |
|||
Specific Spell Restriction: 504<br> |
|||
'''Examine:'''<br>This paper looks interesting... perhaps you should read it. |
|||
</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
|}</blockquote> |
|||
</blockquote> |
|||
<!-- Other Rooms Here --> |
|||
<section end=2020Q3 /> |
|||
==Previous Inventory== |
|||
===Bolt From The Blue Entry=== |
|||
<section begin=current /> |
|||
==Spellbound== |
|||
{{Festshop |
|||
|shopname=Spellbound |
|||
|look=a narrow space between two buildings |
|||
|location=Map Room 16, Lich #26878, go narrow space |
|||
|year=2020 |
|||
|letter=S |
|||
}} |
|||
<!--==={{{ [Spellbound] 26878 2020-02-13 13:48:08 -0600}}}===-->===Spellbound=== |
|||
{{RoomDescription| |
{{RoomDescription| |
||
|roomname= |
|roomname=Spellbound - 26878 |
||
|desc=With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. |
|||
|desc=The narrow walls are painted in shades of midnight blue and stormy grey, the paler hues sweeping in spiraling arcs around a rectangular seascape painting at the back. On opposite sides of the room, a dark-grained mistwood case and a carved white pine chest symmetrically mirror the position of a broad willow-planked hutch, each container illuminated by a solitary hanging silver lantern. |
|||
|exits |
|exits= south, out}} |
||
{{sign|margin-right=40% |
|||
<blockquote> |
|||
|sign=Spell preps! |
|||
In crate: Circles 100-400 |
|||
Behind brick: Circles 500-900 |
|||
On brick: Circles 1000-1700, and ALL casting |
|||
Please READ each paper to see specific restrictions. |
|||
The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, a certificate to increase its maximum charges by 1, and a ticket to add 1 appearance set. Each charge lasts 1 month, and the trinket can be recharged by monks and recharging merchants. |
|||
Items in the case are magical trinkets which automatically recharge daily: |
|||
Deathstone Pin: Spirit Strike (117) - 2x/day |
|||
Heroic Knight Clasp: Heroism (215) - 1x/day |
|||
Green Leaf Symbol: Phoen's Strength (606) - 1x/day |
|||
Sickly Green Sigil: Pestilence (716) - 3x/day |
|||
Green Wavy Symbol: Mass Blur (911) - 1x/day |
|||
Yellow Smooth Cylinder: Arm of the Arkati (1605) - 1x/day |
|||
Wrapped Hand Symbol: Brace (1214) - 1x/day |
|||
Dark Purple Amethyst Pendant: Empathic Focus (1109) - 1x/day |
|||
Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity. |
|||
'''{{big|[[Custom bolt messaging{{!}}Premade bolt messaging]], 2500 BS}} |
|||
New potions on the shelf! |
|||
The wispy orange brew significantly increases one's enchanting skill and comes with 1 dose (old style Enchanting only!). |
|||
The viscous opalescent brew significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). |
|||
The draught significantly increases one's ensorcelling skill and comes with 1 dose. |
|||
Lastly, the bromin (8x), aleteh (9x), and grenshol (10x) potions are for pretempering to enchant items to much higher than normal levels (8-10x).}}<blockquote> |
|||
{{Container| |
{{Container| |
||
|container=In the |
|container=In the sigil-incised display case you see:}} |
||
{| {{prettytable |
{| {{prettytable}} |
||
| a black deathstone pin || Weight: <1 pound || pin-worn<br>functional |
|||
| a white pale fire token || rowspan=2 | [[Fire Spirit (111)]] || You conjure a pale orb of white fire at a giant rat!<br>Person conjures a pale orb of white fire at a giant rat! |
|||
| <div class="mw-customtoggle-ablackdeathstonepin" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablackdeathstonepin">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Spirit Strike]]<br>2 charges<br>rubbing activated<br>persists</div> |
|||
| 10000 |
|||
|- |
|- |
||
| a heroic knight clasp || Weight: <1 pound || pin-worn<br>functional |
|||
| a blue-white flickering fire token || You hurl a flickering ball of blue-white fire at a giant rat!<br>Person hurls a flickering ball of blue-white fire at a giant rat! |
|||
| <div class="mw-customtoggle-aheroicknightclasp" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheroicknightclasp">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Heroism]]<br>1 charge<br>raising activated<br>persists</div> |
|||
| 20000 |
|||
|- |
|- |
||
| a green leaf symbol || Weight: <1 pound || pin-worn<br>functional |
|||
| a white web token || [[Web (118)]] || You shoot thin, silken strands of sticky white webbing at a giant rat!<br>Person shoots thin, silken strands of sticky white webbing at a giant rat! |
|||
| <div class="mw-customtoggle-agreenleafsymbol" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agreenleafsymbol">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Phoen's Strength]]<br>1 charge<br>raising activated<br>persists</div> |
|||
| 15000 |
|||
|- |
|- |
||
| a sickly green sigil || Weight: <1 pound || pin-worn<br>functional |
|||
| a radiant-white whorled water token || rowspan=2|[[Holy Bolt (306)]] || You toss radiant-white whorled water at a giant rat!<br>Person tosses radiant-white whorled water at a giant rat! |
|||
| <div class="mw-customtoggle-asicklygreensigil" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asicklygreensigil">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Pestilence]]<br>3 charges<br>raising activated<br>persists</div> |
|||
| 10000 |
|||
|- |
|- |
||
| a green wavy symbol || Weight: <1 pound || pin-worn<br>functional |
|||
| an incandescent water token || You conjure a stream of incandescent water at a giant rat!<br>Person conjures a stream of incandescent water at a giant rat! |
|||
| <div class="mw-customtoggle-agreenwavysymbol" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agreenwavysymbol">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Mass Blur]]<br>1 charge<br>raising activated<br>persists</div> |
|||
| 10000 |
|||
|- |
|- |
||
| a yellow smooth cylinder || Weight: <1 pound || pin-worn<br>functional |
|||
| a gust of air token || rowspan=3|[[Hand of Tonis (505)]] || You exhale a powerful gust of air at a giant rat!<br>Person exhales a powerful gust of air at a giant rat! |
|||
| <div class="mw-customtoggle-ayellowsmoothcylinder" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ayellowsmoothcylinder">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Arm of the Arkati]]<br>1 charge<br>raising activated<br>persists</div> |
|||
| 10000 |
|||
|- |
|- |
||
| a small wrapped hand symbol || Weight: <1 pound || pin-worn<br>functional |
|||
| a frigid air token || You project a frigid blast of air at a giant rat!<br>Person projects a frigid blast of air at a giant rat! |
|||
| <div class="mw-customtoggle-asmallwrappedhandsymbol" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallwrappedhandsymbol">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Brace]]<br>1 charge<br>raising activated<br>persists</div> |
|||
| 20000 |
|||
|- |
|- |
||
| a dark purple amethyst pendant || Weight: <1 pound || pin-worn<br>functional |
|||
| a howling air token ||You propel a howling blast of air at a giant rat!<br>Person propels a howling blast of air at a giant rat! |
|||
| <div class="mw-customtoggle-adarkpurpleamethystpendant" style="text-decoration: underline">analyze, imbed</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adarkpurpleamethystpendant">'''Analyze:'''<br>This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.<br><br>'''[[Magic Item Use|Imbed]]:'''<br>[[Empathic Focus]]<br>1 charge<br>raising activated<br>persists</div> |
|||
| 100000 |
|||
|- |
|- |
||
|} |
|||
| a craggy rock token || [[Hurl Boulder (510)]] || You conjure a massive craggy rock at a giant rat!<br>Person conjures a massive craggy rock at a giant rat! |
|||
{{Container| |
|||
|container=Under the sigil-incised display case you see:}} |
|||
{| {{prettytable}} |
|||
| a blackened silver necklace set with an orb-caged white pearl || Weight: <1 pound || neck-worn |
|||
| <div class="mw-customtoggle-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablackenedsilvernecklacesetwithanorb-cagedwhitepearl">'''Analyze:'''<br>This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.</div> |
|||
| 25000 |
|||
|- |
|- |
||
| an oval-linked electrum necklace set with a cylinder-caged crimson blazestar || Weight: <1 pound || neck-worn |
|||
| an air vortex token || [[Cone of Elements (518)]] (Air Only) || You summon a tightly focused vortex of air at a giant rat!<br>Person summons a tightly focused vortex of air at a giant rat! |
|||
| <div class="mw-customtoggle-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anoval-linkedelectrumnecklacesetwithacylinder-cagedcrimsonblazestar">'''Analyze:'''<br>This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br><br>'''Show:'''<br>The necklace is made from a perfectly spherical star ruby. The crimson stone is a dark shade of red-black, reflecting Tilaok's current new moon phase. Even the stone's star is dim. An elegant setting of pure platinum holds the miniature moon.</div> |
|||
| 25000 |
|||
|- |
|- |
||
| a slender vaalin necklace set with a square-caged silver starstone || Weight: <1 pound || neck-worn |
|||
| a frayed beam token || rowspan=2 | [[Disintegrate (705)]] || You project a frayed beam of sickly luminescence at a giant rat!<br>Person projects a frayed beam of sickly luminescence at a giant rat! |
|||
| <div class="mw-customtoggle-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aslendervaalinnecklacesetwithasquare-cagedsilverstarstone">'''Analyze:'''<br>This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.<br><br>'''Show:'''<br>The necklace is made from a perfect sphere of polished moonstone. The silvery stone is a dark shade of grey, reflecting Liabo's current new moon phase. A delicate setting of pure platinum holds the miniature moon.</div> |
|||
| 25000 |
|||
|- |
|- |
||
|} |
|||
| a green light token || You summon a sidewinding green light at a giant rat!<br>Person summons a sidewinding green light at a giant rat! |
|||
{{Container| |
|||
|container=In the rune-covered wooden crate you see:}} |
|||
{| {{prettytable}} |
|||
| a jewel-toned striped paper || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-ajewel-tonedstripedpaper" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ajewel-tonedstripedpaper">'''Analyze:'''<br>Invoking this striped paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Grating out a request to the nearby spirits, you leech upon their power for [Spell Name], your veins light up with a dim luminescence.<br>Third Person: Grating out an incomprehensible phrase, Player's eyes flash with power, his veins lighting up with a dim luminescence.<br>Hidden or Invisible: A dim luminescence glows briefly in the shape of a figure, then disappears.<br>Specific Spell Restriction: 103<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a finely scripted palimpsest || Weight: <1 pound || |
|||
| a dark green fireball token || rowspan=2 | [[Balefire (713)]] || You summon a dark green fireball at a giant rat!<br>Person summons a dark green fireball at a giant rat! |
|||
| <div class="mw-customtoggle-afinelyscriptedpalimpsest" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afinelyscriptedpalimpsest">'''Analyze:'''<br>Invoking this scripted palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Murmuring an incantation for [Spell Name], you momentarily feel as if you are flying through the stars, darkness pressing in on you.<br>Third Person: Player's eyelids flicker rapidly and a star-pricked darkness flows across his skin as he murmurs a magical incantation.<br>Hidden or Invisible: You hear soft murmuring.<br>Specific Spell Restriction: 116<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a sun-embossed golden parchment || Weight: <1 pound || |
|||
| a dark noxious orb token || You belch forth a cloud of noxious balefire at a giant rat!<br>Person belches forth a cloud of noxious balefire at a giant rat! |
|||
| <div class="mw-customtoggle-asun-embossedgoldenparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asun-embossedgoldenparchment">'''Analyze:'''<br>Invoking this golden parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tendrils of darksome mist gather about you, swirling upwards, as you beseech the lesser spirits for aid with the [Spell Name] spell...<br>Third Person: Tendrils of darksome mist gather about Player, swirling upwards as he beseeches the lesser spirits for aid...<br>Hidden or Invisible: You hear someone beseeching the lesser spirits for aid.<br>Specific Spell Restriction: 125<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a silver-inked ebon paper || Weight: <1 pound || |
|||
|} |
|||
| <div class="mw-customtoggle-asilver-inkedebonpaper" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilver-inkedebonpaper">'''Analyze:'''<br>Invoking this ebon paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Motes of pearly light dance across your fingers and splay out around you as you quietly, lullingly, whisper the incantation for [Spell Name].<br>Third Person: While Player whispers quietly, lullingly, motes of pearly light dance across his fingers and splay out around him.<br>Hidden or Invisible: Motes of pearly light dance through the air as quiet, lulling whispering floats through the area.<br>Specific Spell Restriction: 202<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
{{Container| |
|||
| 750 |
|||
|container=In the white pine chest hutch you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a scintillating rune token || rowspan=2|[[Minor Shock (901)]] ||You draw a thready, scintillating rune at a giant rat!<br>Person draws a thready, scintillating rune at a giant rat! |
|||
|- |
|- |
||
| a creased powder blue palimpsest || Weight: <1 pound || |
|||
| a radiant spark token || You flick a radiant spark at a giant rat!<br>Person flicks a radiant spark at a giant rat! |
|||
| <div class="mw-customtoggle-acreasedpowderbluepalimpsest" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acreasedpowderbluepalimpsest">'''Analyze:'''<br>Invoking this powder blue palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Preparing [Spell Name], you solicit the spirits with a casual flick of the hand, and tendrils of sanguine thread appear, then wrap around your hand in an agonizingly painful bind before they fade away.<br>Third Person: Player casually flicks his hand, tendrils of sanguine thread appearing and then wrapping tightly around it before they fade away.<br>Hidden or Invisible: Tendrils of sanguine threading appear in the air, then move in an odd but clearly regular pattern before fading away.<br>Specific Spell Restriction: 214<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a heart-stamped bright salmon paper || Weight: <1 pound || |
|||
| a small orb of white lightning token || rowspan=7|[[Minor Shock (901)]] || You conjure a small orb of '''{white}''' lightning at a giant rat!<br>Person conjures a small orb of '''{white}''' lightning at a giant rat! |
|||
| <div class="mw-customtoggle-aheart-stampedbrightsalmonpaper" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheart-stampedbrightsalmonpaper">'''Analyze:'''<br>Invoking this bright salmon paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you gaze off into the distance, concentrating on the thought of a simple litany for [Spell Name], gently flowing wisps of mist rise up and circle around you.<br>Third Person: Player gazes off into the distance, and gently flowing wisps of mist rise up and circle around him.<br>Hidden or Invisible: Gently flowing wisps of mist rise up and float in a circular motion.<br>Specific Spell Restriction: 303<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a midnight blue-starred parchment || Weight: <1 pound || |
|||
| a small orb of red lightning token || '''red |
|||
| <div class="mw-customtoggle-amidnightblue-starredparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-amidnightblue-starredparchment">'''Analyze:'''<br>Invoking this blue-starred parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Platinum energy streaks through your body, your veins and eyes glowing brightly as you growl a violent prayer for [Spell Name].<br>Third Person: Platinum energy streaks through Player's body, his veins and eyes glowing brightly as he growls a violent prayer.<br>Hidden or Invisible: Platinum energy streaks through the air in an odd pattern as a violent prayer pierces the air.<br>Specific Spell Restriction: 317<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a |
| a hideous lumpy brown scroll || Weight: <1 pound || |
||
| <div class="mw-customtoggle-ahideouslumpybrownscroll" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ahideouslumpybrownscroll">'''Analyze:'''<br>Invoking this lumpy brown scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you gesture precise movements for the [Spell Name] spell, your fingers transform into elongated objects before returning to their original shape...<br>Third Person: Player gestures precise movements, and for a moment, his fingers transform into elongated objects.<br>Hidden or Invisible:<br>Specific Spell Restriction: 403<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| an ale-stained half-bound scroll || Weight: <1 pound || |
|||
| a small orb of purple lightning token || '''purple |
|||
| <div class="mw-customtoggle-anale-stainedhalf-boundscroll" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anale-stainedhalf-boundscroll">'''Analyze:'''<br>Invoking this half-bound scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Murmuring a soothing invocation for [Spell Name], bright arcs of elemental energy spark around you as you pull on their power.<br>Third Person: Murmuring a soothing invocation, bright arcs of elemental energy spark around Player.<br>Hidden or Invisible: Bright arcs of elemental energy spark through the air.<br>Specific Spell Restriction: 405<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a wide-striped blue and gold palimpsest || Weight: <1 pound || |
|||
| a small orb of green lightning token || '''green |
|||
| <div class="mw-customtoggle-awide-stripedblueandgoldpalimpsest" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awide-stripedblueandgoldpalimpsest">'''Analyze:'''<br>Invoking this blue and gold palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You close your eyes and twin beams of violet light issue from your illuminated eye sockets as you invoke the powers of the elements for the [Spell Name] spell...<br>Third Person: Player closes his eyes and twin beams of violet light issue from his illuminated eye sockets as he invokes the powers of the elements.<br>Hidden or Invisible: You hear someone invoking the powers of the elements.<br>Specific Spell Restriction: 416<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| an ink-blotted coppery papyrus || Weight: <1 pound || |
|||
| a small orb of orange lightning token || '''orange |
|||
| <div class="mw-customtoggle-anink-blottedcopperypapyrus" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anink-blottedcopperypapyrus">'''Analyze:'''<br>Invoking this coppery papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You draw an abstruse sigil for [Spell Name] in the air with your fingers, and brilliant light swirls up out of your pores.<br>Third Person: Player draws an abstruse sigil in the air with his fingers, and brilliant light swirls up out of his pores.<br>Hidden or Invisible: Brilliant light swirls around the area.<br>Specific Spell Restriction: 419<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
| a small orb of yellow lightning token || '''yellow |
|||
{{Container| |
|||
|container=On the brick you see:}} |
|||
{| {{prettytable}} |
|||
| a frayed-edge ivory vellum || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-afrayed-edgeivoryvellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-afrayed-edgeivoryvellum">'''Analyze:'''<br>Invoking this ivory vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Breaking into a tortured song for [Spell Name], you focus on crafting a tune rife with loathing and distress.<br>Third Person: Player breaks into a tortured song, crafting a tune rife with loathing and distress.<br>Hidden or Invisible: A tortured song drifts through the area, its tune rife with loathing and distress.<br>Specific Spell Restriction: 1001<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a hastily scrawled papyrus || Weight: <1 pound || |
|||
| a crackling sigil rune || rowspan=3|[[Major Shock (910)]] || You project a complex sigil composed of crackling energy at a giant rat!<br>Person projects a complex sigil composed of crackling energy at a giant rat! |
|||
| <div class="mw-customtoggle-ahastilyscrawledpapyrus" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ahastilyscrawledpapyrus">'''Analyze:'''<br>Invoking this scrawled papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Drawing in a long breath to prepare [Spell Name], you eke out an off-key melody fit for shattering glass, and a sharp pain stabs your mind.<br>Third Person: Player draws in a long breath, his expression suddenly pained as he ekes out an off-key melody fit for shattering glass.<br>Hidden or Invisible: An off-key melody fit for shattering glass fills the air.<br>Specific Spell Restriction: 1019<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| an onyx-dusted pristine white palimpsest || Weight: <1 pound || |
|||
| a splintered arc rune || You release a splintered arc of searing electricity at a giant rat!<br>Person releases a splintered arc of searing electricity at a giant rat! |
|||
| <div class="mw-customtoggle-anonyx-dustedpristinewhitepalimpsest" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anonyx-dustedpristinewhitepalimpsest">'''Analyze:'''<br>Invoking this pristine white palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You close your eyes and focus on [Spell Name], envPlayering how your limbs' anatomical structure -- the tendons, muscles, bones, blood vessels -- all work together in perfect harmony.<br>Third Person: Player closes his eyes, and the skin on his limbs briefly fades to translucency, the anatomical structure -- the tendons, muscles, bones, blood vessels -- visible for a mere moment.<br>Hidden or Invisible:<br>Specific Spell Restriction: 1102<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a wax-crusted pale violet scroll || Weight: <1 pound || |
|||
| a green lightning rune ||You release a jagged chain of pale green lightning at a giant rat!<br>Person releases a jagged chain of pale green lightning at a giant rat! |
|||
| <div class="mw-customtoggle-awax-crustedpalevioletscroll" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awax-crustedpalevioletscroll">'''Analyze:'''<br>Invoking this pale violet scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you raise your hands up to prepare the [Spell Name] spell and insistently beckon several spirits to you, the faint outlines of their caliginous shadows flutter in and out of sight.<br>Third Person: The faint outlines of caliginous shadows flutter in and out of sight around Player as he raises his hands in an insistently beckoning manner.<br>Hidden or Invisible: The faint outlines of caliginous shadows flutter in and out of sight.<br>Specific Spell Restriction: 1115<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a beige flower-pressed vellum || Weight: <1 pound || |
|||
| a black spark rune || rowspan=8|[[Major Shock (910)]] || You conjure a crackling orb of '''{black}''' lightning at a giant rat!<br>Person conjures a crackling orb of '''{black}''' lightning at a giant rat! |
|||
| <div class="mw-customtoggle-abeigeflower-pressedvellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abeigeflower-pressedvellum">'''Analyze:'''<br>Invoking this flower-pressed vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Crooning the [Spell Name] spell in an archaic tongue, you focus on the passage of time, quickly shuttering the past and the present away.<br>Third Person: As Player croons an archaic phrase, he stares off into the distance, his eyes briefly turning to pools of marbled argent.<br>Hidden or Invisible: You hear soft crooning sounds.<br>Specific Spell Restriction: 1204<br><br>'''Show:'''<br>This vellum looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a mossy green folded parchment || Weight: <1 pound || |
|||
| a white spark rune || '''white |
|||
| <div class="mw-customtoggle-amossygreenfoldedparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-amossygreenfoldedparchment">'''Analyze:'''<br>Invoking this green folded parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Clearing your mind of all but the [Spell Name] spell, you touch the tips of your fingers together and focus on the single thought of terrible pain slicing outward from them.<br>Third Person: Player touches the tips of his fingers together, a cruel expression flitting across his features.<br>Hidden or Invisible:<br>Specific Spell Restriction: 1210<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a stained tart-stamped scroll || Weight: <1 pound || |
|||
| a blue spark rune || '''blue |
|||
| <div class="mw-customtoggle-astainedtart-stampedscroll" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-astainedtart-stampedscroll">'''Analyze:'''<br>Invoking this tart-stamped scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Calling forth the [Spell Name] spell with the intonation of a single syllable, a murky shroud peels away from you and vanishes.<br>Third Person: As Player intones a spell with a single syllable, a murky shroud peels away from him and vanishes.<br>Hidden or Invisible: You hear a single intoned syllable.<br>Specific Spell Restriction: 1606<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| an iridescent tangerine papyrus || Weight: <1 pound || |
|||
| a purple spark rune || '''purple |
|||
| <div class="mw-customtoggle-aniridescenttangerinepapyrus" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aniridescenttangerinepapyrus">'''Analyze:'''<br>Invoking this tangerine papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Waves of argentine light curl around you, embracing and seeping into you as you call upon your patron for [Spell Name].<br>Third Person: Waves of argentine light curl around Player, embracing and seeping into him as he calls upon his patron.<br>Hidden or Invisible: Waves of argentine light appear to curl through the air until they disappear.<br>Specific Spell Restriction: 1615<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| an embossed clover green vellum || Weight: <1 pound || |
|||
| a red spark rune || '''red |
|||
| <div class="mw-customtoggle-anembossedclovergreenvellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-anembossedclovergreenvellum">'''Analyze:'''<br>Invoking this clover green vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: A haze of noxious vapor forms in the air overhead as you recite the esoteric command for [Spell Name]...<br>Third Person: A haze of noxious vapor forms in the air overhead as Player recites an esoteric command.<br>Hidden or Invisible: You hear someone reciting an esoteric command.<br>Specific Spell Restriction: 109<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a translucent alabaster vellum || Weight: <1 pound || |
|||
| a green spark rune || '''green |
|||
| <div class="mw-customtoggle-atranslucentalabastervellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentalabastervellum">'''Analyze:'''<br>Invoking this alabaster vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: A haze of black mist gathers around you as you prepare [Spell Name]...<br>Third Person: A haze of black mist gathers around Player as he prepares a spell...<br>Hidden or Invisible: A haze of black mist appears and slowly dissipates.<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a |
| a cat paw-printed paper || Weight: <1 pound || |
||
| <div class="mw-customtoggle-acatpaw-printedpaper" style="text-decoration: underline">analyze, show description</div> |
|||
|- |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acatpaw-printedpaper">'''Analyze:'''<br>Invoking this paw-printed paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Wisps of crimson light materialize in your palms, slowly floating into the air and disappearing as you chant the phrase for [Spell Name]...<br>Third Person: Wisps of crimson light materialize in Player's palms, slowly floating into the air and disappearing as he chants a phrase...<br>Hidden or Invisible: Wisps of crimson light float into the air.<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| an orange spark rune || '''orange |
|||
| 750 |
|||
|- |
|- |
||
|} |
|} |
||
{{Container| |
{{Container| |
||
|container= |
|container=Behind the brick you see:}} |
||
{| {{prettytable |
{| {{prettytable}} |
||
| a wavy-edged azure vellum || Weight: <1 pound || |
|||
| a cloud bauble || rowspan=3|[[Minor Steam (1707)]] || You exhale a seething blast of steam at a giant rat!<br>Person exhales a seething blast of steam at a giant rat! |
|||
| <div class="mw-customtoggle-awavy-edgedazurevellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awavy-edgedazurevellum">'''Analyze:'''<br>Invoking this azure vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Swiping your hand emphatically through the air, you deliberately slow its motion as you finish the stylized gesture for the [Spell Name] spell.<br>Third Person: Player swipes his hand emphatically through the air, his motion slowing significantly as he finishes the stylized gesture.<br>Hidden or Invisible:<br>Specific Spell Restriction: 504<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a gold-inked dark burgundy parchment || Weight: <1 pound || |
|||
| a steam bauble || You summon a blistering wave of steam at a giant rat!<br>Person summons a blistering wave of steam at a giant rat! |
|||
| <div class="mw-customtoggle-agold-inkeddarkburgundyparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agold-inkeddarkburgundyparchment">'''Analyze:'''<br>Invoking this dark burgundy parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Barking an order at the ground below you to prepare the [Spell Name] spell, you feel it respond with a light tremble that sends a jolt of elemental energy racing through you.<br>Third Person: Player barks an order at the ground below him, and it trembles lightly in response.<br>Hidden or Invisible: The ground trembles lightly.<br>Specific Spell Restriction: 514<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a leaf-shaped pale green paper || Weight: <1 pound || |
|||
| a rolling fog bauble || You propel a roiling wave of hissing fog at a giant rat!<br>Person propels a roiling wave of hissing fog at a giant rat! |
|||
| <div class="mw-customtoggle-aleaf-shapedpalegreenpaper" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aleaf-shapedpalegreenpaper">'''Analyze:'''<br>Invoking this pale green paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You envPlayer a forest growing up around you, evergreen trees bending down toward you to listen to your incantation of [Spell Name].<br>Third Person: For just a moment, Player appears to be surrounded by evergreen trees bending toward him to listen to his magical incantation.<br>Hidden or Invisible:<br>Specific Spell Restriction: 605<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a neat aquamarine papyrus || Weight: <1 pound || |
|||
|} </blockquote> |
|||
| <div class="mw-customtoggle-aneataquamarinepapyrus" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aneataquamarinepapyrus">'''Analyze:'''<br>Invoking this aquamarine papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you quickly call forth the [Spell Name] spell, variegated pale turquoise light encompasses your hands.<br>Third Person: As Player chants a magical phrase, variegated pale turquoise light encompasses his hands.<br>Hidden or Invisible: Variegated pale turquoise light briefly lights up the area.<br>Specific Spell Restriction: 619<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
===BftB Niche=== |
|||
{{RoomDescription| |
|||
|roomname=Bolt From The Blue, Niche |
|||
|desc=A faint note of ozone hangs lightly in the air, aptly playing off the sky blue tones used in the niche's interior. Finely honed woodworking skills are presented in the forms of a glossy mahogany counter and a lacquered oak table placed at the center of the space. Stacked neatly at the back, some golden spinewood crates sit next to an oversized iron-bound trunk that is incised with an array of silvery glyphs and symbols. |
|||
|exits = north, west}} |
|||
<blockquote> |
|||
'''{{big|[[Custom bolt messaging{{!}}Premade bolt messaging]], 2500 BS}} |
|||
{{Container| |
|||
|container=On the mahogany counter you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a craggy ice chunk ornament ||rowspan=2| [[Minor Cold (1709)]] || You conjure a craggy ice chunk at a giant rat!<br>Person conjures a craggy ice chunk at a giant rat! |
|||
|- |
|- |
||
| a simple light grey scroll || Weight: <1 pound || |
|||
| a jagged snowy rock ornament || You summon a jagged snow-covered rock at a giant rat!<br>Person summons a jagged snow-covered rock at a giant rat! |
|||
| <div class="mw-customtoggle-asimplelightgreyscroll" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asimplelightgreyscroll">'''Analyze:'''<br>Invoking this light grey scroll will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Your body flushes with a blood red hue, your veins standing out from your skin, as you incant a mantra for [Spell Name].<br>Third Person: Player's body flushes a blood red hue, his veins standing out from his skin and twisting his features, as he incants a mantra.<br>Hidden or Invisible: You hear a quiet incantation.<br>Specific Spell Restriction: 701<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a neatily creased parchment || Weight: <1 pound || |
|||
| a blue ice orb trinket ||rowspan=3| [[Major Cold (907)]] || You summon a glistening orb of blue ice at a giant rat!<br>Person summons a glistening orb of blue ice at a giant rat! |
|||
| <div class="mw-customtoggle-aneatilycreasedparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aneatilycreasedparchment">'''Analyze:'''<br>Invoking this creased parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: The flesh of your fingers blackens as you breathe in deeply, blood seeping out around your knuckles, then returns to normal as you focus on preparing [Spell Name].<br>Third Person: The flesh of Player's fingers blackens, blood seeping out around his knuckles as he breathes in deeply, then returns to normal.<br>Hidden or Invisible:<br>Specific Spell Restriction: 712<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a blue-inked deep tan papyrus || Weight: <1 pound || |
|||
| a blistering orb trinket || You summon a blistering cold orb at a giant rat!<br>Person summons a blistering cold orb at a giant rat! |
|||
| <div class="mw-customtoggle-ablue-inkeddeeptanpapyrus" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ablue-inkeddeeptanpapyrus">'''Analyze:'''<br>Invoking this deep tan papyrus will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: The whites of your eyes glow a luminous green around the black depths of your pupils as you forcefully invoke [Spell Name]...<br>Third Person: The whites of Player's eyes glow a luminous green around the black depths of his pupils as he forcefully invokes a spell.<br>Hidden or Invisible: You hear someone forcefully invoking a spell.<br>Specific Spell Restriction: 713<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a ragged and stained paper || Weight: <1 pound || |
|||
| an icy shard trinket || You let fly a fractured stream of icy shards at a giant rat!<br>Person lets fly a fractured stream of icy shards at a giant rat! |
|||
| <div class="mw-customtoggle-araggedandstainedpaper" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-araggedandstainedpaper">'''Analyze:'''<br>Invoking this stained paper will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Your eyes roll back into your head and your body heaves spasmodically as the invocation of the [Spell Name] spell issues from the rictus of your gaping mouth...<br>Third Person: Player's eyes roll back into his head and his body heaves spasmodically as an invocation issues from his gaping mouth.<br>Hidden or Invisible: You hear someone invoking a spell.<br>Specific Spell Restriction: 725<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a scalloped light yellow vellum || Weight: <1 pound || |
|||
|} |
|||
| <div class="mw-customtoggle-ascallopedlightyellowvellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ascallopedlightyellowvellum">'''Analyze:'''<br>Invoking this light yellow vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: You feel energy ripple around you in chaotic waves, and you yank it toward you as you prepare the [Spell Name] spell.<br>Third Person: Player's eyes darken, then glow with chaotically shifting light, as he chants a magical phrase.<br>Hidden or Invisible: You hear someone chant a magical phrase.<br>Specific Spell Restriction: 905<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
{{Container| |
|||
| 750 |
|||
|container=On the oak table you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a translucent statue || rowspan=2| [[Empathic Assault (1110)]] ||You summon a translucent orb of shifting plasma at a giant rat!<br>Person summons a translucent orb of shifting plasma at a giant rat! |
|||
|- |
|- |
||
| a rolled and stamped palimpsest || Weight: <1 pound || |
|||
| a pure white statue || You conjure a shifting orb of pure white energy at a giant rat!<br>Person conjures a shifting orb of pure white energy at a giant rat! |
|||
| <div class="mw-customtoggle-arolledandstampedpalimpsest" style="text-decoration: underline">analyze, show description</div> |
|||
|- |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-arolledandstampedpalimpsest">'''Analyze:'''<br>Invoking this stamped palimpsest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: As you draw heated power from the earth for the [Spell Name] spell, bits of flesh flake off of your skin, rising up into the air and turning to brightly burning cinders that whirl around you.<br>Third Person: Bits of flesh flake off of Player's skin, rising up into the air and turning to brightly burning cinders that whirl around him.<br>Hidden or Invisible: Brightly burning cinders whirl through the air.<br>Specific Spell Restriction: 917<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| a white statue ||rowspan=8| [[Empathic Assault (1110)]] ||You conjure a shifting orb of '''{white}''' plasma at a giant rat!<br>Person conjures a shifting orb of '''{white}''' plasma at a giant rat! |
|||
| 750 |
|||
|- |
|- |
||
| a soot-dusted yellowing parchment || Weight: <1 pound || |
|||
| a red statue || '''red |
|||
| <div class="mw-customtoggle-asoot-dustedyellowingparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoot-dustedyellowingparchment">'''Analyze:'''<br>Invoking this yellowing parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: A great mass of turbulent air roils before you as you invoke the phrase for [Spell Name]...<br>Third Person: A great mass of turbulent air roils before Player as he invokes a magical phrase.<br>Hidden or Invisible: You hear someone invoking a magical phrase.<br>Specific Spell Restriction: 912<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
| a purple statue || '''purple |
|||
{{Container| |
|||
|container=On the small round table you see:}} |
|||
{| {{prettytable}} |
|||
| a violet-tinted electrum monocle || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-aviolet-tintedelectrummonocle" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviolet-tintedelectrummonocle">'''Analyze:'''<br>A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div> |
|||
| 1500 |
|||
|- |
|- |
||
| a reflective gold-rimmed monocle || Weight: <1 pound || |
|||
| a black statue || '''black |
|||
| <div class="mw-customtoggle-areflectivegold-rimmedmonocle" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-areflectivegold-rimmedmonocle">'''Analyze:'''<br>A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div> |
|||
| 1500 |
|||
|- |
|- |
||
| a bent-framed brass monocle || Weight: <1 pound || |
|||
| a green statue || '''green |
|||
| <div class="mw-customtoggle-abent-framedbrassmonocle" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abent-framedbrassmonocle">'''Analyze:'''<br>A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div> |
|||
| 1500 |
|||
|- |
|- |
||
| a heavy invar monocle || Weight: <1 pound || |
|||
| an orange statue || '''orange |
|||
| <div class="mw-customtoggle-aheavyinvarmonocle" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aheavyinvarmonocle">'''Analyze:'''<br>A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.<br>This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.<br>USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]<br>Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear<br>Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.<br>Currently, the monocle is not toggled and will be worn normally.<br>This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.</div> |
|||
| 1500 |
|||
|- |
|- |
||
|} |
|||
| a blue statue || '''blue |
|||
|- |
|||
| a yellow statue || '''yellow |
|||
|- |
|||
|} |
|||
{{Container| |
{{Container| |
||
|container= |
|container=On the dilapidated wooden shelf you see:}} |
||
{| {{prettytable |
{| {{prettytable}} |
||
| a viscous opalescent brew || Weight: <1 pound || |
|||
| a hissing fluid token || rowspan=7| [[Minor Acid (904)]] || You direct a stream of caustic, hissing fluid at a giant rat!<br>Person directs a stream of caustic, hissing fluid at a giant rat! |
|||
| <div class="mw-customtoggle-aviscousopalescentbrew" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aviscousopalescentbrew">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.</div> |
|||
| 50000 |
|||
|- |
|- |
||
| a grenshol potion || Weight: 2 pounds || || |
|||
| a greenish brown acid token || You direct a stream of greenish brown acid at a giant rat!<br>Person directs a stream of greenish brown acid at a giant rat! |
|||
| 30000 |
|||
|- |
|- |
||
| an aleteh potion || Weight: 2 pounds || || |
|||
| a caustic green liquid token || You summon a stream of caustic green liquid at a giant rat!<br>Person summons a stream of caustic green liquid at a giant rat! |
|||
| 25000 |
|||
|- |
|- |
||
| a bromin potion || Weight: 2 pounds || || |
|||
| a green acid token || You belch caustic green liquid at a giant rat!<br>Person belches caustic green liquid at a giant rat! |
|||
| 20000 |
|||
|- |
|- |
||
| a wispy orange brew || Weight: <1 pound || |
|||
| an acrid mist token || You spray forth a hazy, acrid mist at a giant rat!<br>Person sprays forth a hazy, acrid mist at a giant rat! |
|||
| <div class="mw-customtoggle-awispyorangebrew" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awispyorangebrew">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.</div> |
|||
| 50000 |
|||
|- |
|- |
||
| a shimmering trinket || Weight: <1 pound || pin-worn |
|||
| an acid spray token || You spit a messy spray of bitter liquid at a giant rat!<br>Person spits a messy spray of bitter liquid at a giant rat! |
|||
| <div class="mw-customtoggle-ashimmeringtrinket" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringtrinket">'''Analyze:'''<br>The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.<br>It is not currently active, but is using set 1 (out of 1): nothing special at this time.<br>The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.<br>You can tell that the trinket is as light as it can get.<br><br>'''Show:'''<br>A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.</div> |
|||
| 5000 |
|||
|- |
|- |
||
| a bubbling bright green draught || Weight: <1 pound || |
|||
| a greenish gob token || You hawk loudly and spit a greenish-yellow gob at a giant rat!<br>Person hawks loudly and spits a greenish-yellow gob at a giant rat! |
|||
| <div class="mw-customtoggle-abubblingbrightgreendraught" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abubblingbrightgreendraught">'''Analyze:'''<br>Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught. A bard may be able to provide more specifics.</div> |
|||
| 50000 |
|||
|- |
|- |
||
| a dog-eared brown suede tome || Weight: <1 pound || |
|||
| a bilious miasma stone || rowspan=4| [[Major Acid (1710)]] || You exhale a dark and bilious miasma at a giant rat!<br>Person exhales a dark and bilious miasma at a giant rat! |
|||
| <div class="mw-customtoggle-adog-earedbrownsuedetome" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-adog-earedbrownsuedetome">'''Analyze:'''<br>This brown suede tome is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>Try as you might, you cannot get a good sense of whether or not the tome's pockets could get any deeper, but you can tell that the tome is as light as it can get.</div> |
|||
| 2000 |
|||
|- |
|- |
||
| an immaculate white leather codex || Weight: <1 pound || |
|||
| a green miasma stone || You throw a green orb of hissing miasma at a giant rat!<br>Person throws a green orb of hissing miasma at a giant rat! |
|||
| <div class="mw-customtoggle-animmaculatewhiteleathercodex" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-animmaculatewhiteleathercodex">'''Analyze:'''<br>This white leather codex is a heavily scripted fluff book. It can be altered freely so long as it remains a book.<br>Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE<br>TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.<br>Try as you might, you cannot get a good sense of whether or not the codex's pockets could get any deeper, but you can tell that the codex is as light as it can get.</div> |
|||
| 2000 |
|||
|- |
|- |
||
| a bulbous vibrant crimson bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| |
|||
| a caustic orb stone || You exhale a caustic green orb at a giant rat!<br>Person exhales a caustic green orb at a giant rat! |
|||
| <div class="mw-customtoggle-abulbousvibrantcrimsonbottle" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-abulbousvibrantcrimsonbottle">'''Analyze:'''<br>This vibrant crimson bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 50 items. PUT items in to store them. SHAKE the bottle to get them back out.</div> |
|||
| 100 |
|||
|- |
|- |
||
| a gold-caged lustrous green jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| |
|||
| an acrid mist stone || You project a hissing torrent of acrid mist at a giant rat!<br>Person projects a hissing torrent of acrid mist at a giant rat! |
|||
| <div class="mw-customtoggle-agold-cagedlustrousgreenjar" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-agold-cagedlustrousgreenjar">'''Analyze:'''<br>This lustrous green jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 50 items. PUT items in to store them. SHAKE the jar to get them back out.</div> |
|||
| 100 |
|||
|- |
|- |
||
| a silver-chased dark purple bottle || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| |
|||
|} |
|||
| <div class="mw-customtoggle-asilver-chaseddarkpurplebottle" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilver-chaseddarkpurplebottle">'''Analyze:'''<br>This dark purple bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 100 items. PUT items in to store them. SHAKE the bottle to get them back out.</div> |
|||
{{Container| |
|||
| 250 |
|||
|container=In the iron-bound trunk you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a white-hot fireball button || rowspan=8|[[Major Fire (908)]] || You belch a white-hot fireball at a giant rat!<br>Person belches a white-hot fireball at a giant rat! |
|||
|- |
|- |
||
| a squat pale pink jar || Weight: <1 pound <br>Pocketed: Very small (<2-4)<br>one item|| |
|||
| a flame sigil button ||You project a sigil wrought of smoke and flame at a giant rat!<br>Person projects a sigil wrought of smoke and flame at a giant rat! |
|||
| <div class="mw-customtoggle-asquatpalepinkjar" style="text-decoration: underline">analyze</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asquatpalepinkjar">'''Analyze:'''<br>This pale pink jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.<br>Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.<br>It can hold a maximum of 100 items. PUT items in to store them. SHAKE the jar to get them back out.</div> |
|||
| 250 |
|||
|- |
|- |
||
| a shimmering certificate || Weight: <1 pound || |
|||
| a smoldering orb button || You exhale a smoldering orb of flames at a giant rat!<br>Person exhales a smoldering orb of flames at a giant rat! |
|||
| <div class="mw-customtoggle-ashimmeringcertificate" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-ashimmeringcertificate">'''Analyze:'''<br>Your certificate is used to unlock the potential of things held in your other hand.<br>The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.<br>You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.<br>Your certificate may not be altered or changed in any way.<br><br>'''Show:'''<br>As you glance over the certificate you notice something written on it...<br>This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.</div> |
|||
| 1000 |
|||
|- |
|- |
||
| a glittering ticket || Weight: <1 pound || |
|||
| a bonfire flames button || You exhale a bonfire-sized gout of flames at a giant rat!<br>Person exhales a bonfire-sized gout of flames at a giant rat! |
|||
| <div class="mw-customtoggle-aglitteringticket" style="text-decoration: underline">analyze, show description</div> |
|||
|- |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aglitteringticket">'''Analyze:'''<br>Your ticket is used to unlock the potential of things held in your other hand.<br>The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).<br>You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.<br>Your ticket may not be altered or changed in any way.<br><br>'''Show:'''<br>As you glance over the ticket you notice something written on it...<br>This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).</div> |
|||
| an orb of carmine flames button || You breathe out a cloud of carmine flames and sulphurous fumes at a giant rat!<br>Person breathes out a cloud of carmine flames and sulphurous fumes at a giant rat! |
|||
| 3500 |
|||
|- |
|||
| a flaming sputum button || You hawk up and spit a seething gob of flaming sputum at a giant rat!<br>Person hawks up and spits a seething gob of flaming sputum at a giant rat! |
|||
|- |
|||
| a sheet of fire token || You spray a molten sheet of fire at a giant rat!<br>Person sprays a molten sheet of fire at a giant rat! |
|||
|- |
|||
| a stream of fire button || You spit a stream of seething liquid fire at a giant rat!<br>Person spits a stream of seething liquid fire at a giant rat! |
|||
|- |
|- |
||
|} |
|||
| an orb of white fire button || rowspan=8|[[Major Fire (908)]] ||You summon a fiery orb of '''{white}''' fire at a giant rat!<br>Person summons a fiery orb of '''{white}''' fire at a giant rat! |
|||
</blockquote> |
|||
|- |
|||
<!-- additional room --> |
|||
| an orb of red fire button || '''red |
|||
{{Festshop |
|||
|- |
|||
|shopname=Spellbound, Crevice |
|||
| an orb of black fire button || '''black |
|||
|look=crevice |
|||
|- |
|||
|location=Lich# 26878, south |
|||
| an orb of purple fire button || '''purple |
|||
|year=2020 |
|||
|- |
|||
|letter=S |
|||
| an orb of blue fire button || '''blue |
|||
}} |
|||
|- |
|||
<!--==={{{ [Spellbound, Crevice] 26881 2020-02-13 13:36:29 -0600}}}===-->===Spellbound, Crevice=== |
|||
| an orb of green fire button || '''green |
|||
|- |
|||
| an orb of orange fire button || '''orange |
|||
|- |
|||
| an orb of yellow fire button || '''yellow |
|||
|- |
|||
|} </blockquote> |
|||
===BftB Nook=== |
|||
{{RoomDescription| |
{{RoomDescription| |
||
|roomname= |
|roomname=Spellbound, Crevice - 26881 |
||
|desc=Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. |
|||
|desc=Ivory-swept dark grey silk walls wrap around the semi-circular nook area, providing a pleasingly stark backdrop for a pewter-set ivory stand and a beveled ironwood sideboard. Tiny clusters of silvery lights are suspended in a gentle wave configuration from the ceiling, illuminating an ornate willow receptacle resting in the middle of the room. |
|||
|exits |
|exits= north}} |
||
<blockquote> |
<blockquote> |
||
'''{{big|[[Custom bolt messaging{{!}}Premade bolt messaging]], 2500 BS}} |
|||
{{Container| |
{{Container| |
||
|container=On the |
|container=On the dilapidated birch shelf you see:}} |
||
{| {{prettytable |
{| {{prettytable}} |
||
| a smooth off-white vellum || Weight: <1 pound || |
|||
| a kaleidoscopic coin || [[Arcane Blast (1700)]] || You fling a mote of kaleidoscopic energy at a giant rat!<br>Person flings a mote of kaleidoscopic energy at a giant rat! |
|||
| <div class="mw-customtoggle-asmoothoff-whitevellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmoothoff-whitevellum">'''Analyze:'''<br>Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your blue-grey eyes flash with a holy light as you release the [Spell Name] spell...<br>Third Person: Cajoling the lesser spirits, Player utters a lyrical prayer that is accompanied by simple gestures. His blue-grey eyes flash with a holy light as he releases his spell.<br>Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.<br>Specific Spell Restriction: 103<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a translucent cream-hued vellum || Weight: <1 pound || |
|||
|} |
|||
| <div class="mw-customtoggle-atranslucentcream-huedvellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-atranslucentcream-huedvellum">'''Analyze:'''<br>Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your blue-grey eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...<br>Third Person: Closing his eyes tightly, Player appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his blue-grey eyes fly wide open and he flicks his fingers, releasing his spell.<br>Hidden or Invisible: Blue-grey light suddenly flashes in the air.<br>Specific Spell Restriction: 116<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
{{Container| |
|||
| 750 |
|||
|container=On the ironwood sideboard you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a flaming rune charm || rowspan=3| [[Minor Fire (906)]] || You fling a flickering stream of flaming runes at a giant rat!<br>Person flings a flickering stream of flaming runes at a giant rat! |
|||
|- |
|- |
||
| a silvery lightning-motif vellum || Weight: <1 pound || |
|||
| an incandescent flames charm || You spew a jet of incandescent flames at a giant rat!<br>Person spews a jet of incandescent flames at a giant rat! |
|||
| <div class="mw-customtoggle-asilverylightning-motifvellum" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asilverylightning-motifvellum">'''Analyze:'''<br>Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your fair skin as you release the stored energy of the [Spell Name] spell...<br>Third Person: Curling his fingers into claws, Player forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar energy crackles across the surface of his fair skin as he releases the stored energy of his spell.<br>Hidden or Invisible: Zorchar energy crackles through the air.<br>Specific Spell Restriction: 125<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a small scale-shaped parchment || Weight: <1 pound || |
|||
| a white-hot flame charm || You blow a white-hot jet of flame at a giant rat!<br>Person blows a white-hot jet of flame at a giant rat! |
|||
| <div class="mw-customtoggle-asmallscale-shapedparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asmallscale-shapedparchment">'''Analyze:'''<br>Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...<br>Third Person: Sibilantly forming the simple words of his prayer, Player implores shadows and darkness to protect him.<br>Hidden or Invisible: Sibilant prayers issue from the darkness.<br>Specific Spell Restriction: 303<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| an inky black palimpest || Weight: <1 pound || |
|||
| a jet of white fire charm || rowspan=8| [[Minor Fire (906)]] || You breathe a jet of sizzling '''{white}''' fire at a giant rat!<br>Person breathes a jet of sizzling '''{white}''' fire at a giant rat! |
|||
| <div class="mw-customtoggle-aninkyblackpalimpest" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-aninkyblackpalimpest">'''Analyze:'''<br>Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your blue-grey eyes and transforms into a [Spell Name] before you...<br>Third Person: Flexing his fingers slightly, Player's form begins to darken and shadows seep from his blue-grey eyes. Player releases his spell by transforming that darkness around him into a spiritual shield.<br>Hidden or Invisible: Darkness briefly pools about the area.<br>Specific Spell Restriction: 202<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a thin shadowy black parchment || Weight: <1 pound || |
|||
| a jet of red fire charm ||'''red |
|||
| <div class="mw-customtoggle-athinshadowyblackparchment" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-athinshadowyblackparchment">'''Analyze:'''<br>Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tenebrous shadows slip across your fair skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vPlayer and you release your [Spell Name]...<br>Third Person: Tenebrous shadows slip across Player's fair skin as he demands divinity to heed his prayers. As if in answer, his blue-grey eyes briefly blacken as he releases his fury.<br>Hidden or Invisible:<br>Specific Spell Restriction: 317<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
| a jet of black fire charm ||'''black |
|||
{{Container| |
|||
|container=On the decaying oaken slab you see:}} |
|||
{| {{prettytable}} |
|||
| a coin-edged piece of sheet music || Weight: <1 pound || |
|||
| <div class="mw-customtoggle-acoin-edgedpieceofsheetmusic" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-acoin-edgedpieceofsheetmusic">'''Analyze:'''<br>Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...<br>Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Player weaves the simple somatic components of a spell into the air.<br>Hidden or Invisible: Rising on the air is a familiar ditty.<br>Specific Spell Restriction: 403<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a |
| a sheet of watermarked music || Weight: <1 pound || |
||
| <div class="mw-customtoggle-asheetofwatermarkedmusic" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asheetofwatermarkedmusic">'''Analyze:'''<br>Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...<br>Third Person: Lifting his voice in song, Player spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.<br>Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.<br>Specific Spell Restriction: 405<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a violet cotton sheet || Weight: <1 pound || |
|||
| a jet of blue fire charm ||'''blue |
|||
| <div class="mw-customtoggle-avioletcottonsheet" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-avioletcottonsheet">'''Analyze:'''<br>Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tracing simple lines upon your fair brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third blue-grey eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...<br>Third Person: Tracing simple lines upon his fair brow, Player invokes the elements and almost instantly a third blue-grey eye opens in his forehead. Seconds after he releases the spell, the eye fades away.<br>Hidden or Invisible:<br>Specific Spell Restriction: 416<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a soft sigil-etched sheet || Weight: <1 pound || |
|||
| a jet of green fire charm ||'''green |
|||
| <div class="mw-customtoggle-asoftsigil-etchedsheet" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-asoftsigil-etchedsheet">'''Analyze:'''<br>Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...<br>Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Player invokes the elements as he casts his spell.<br>Hidden or Invisible:<br>Specific Spell Restriction: 419<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
| a whorl-edged cloud white note || Weight: <1 pound || |
|||
| a jet of orange fire charm ||'''orange |
|||
| <div class="mw-customtoggle-awhorl-edgedcloudwhitenote" style="text-decoration: underline">analyze, show description</div> |
|||
<div class="mw-collapsible mw-collapsed" id="mw-customcollapsible-awhorl-edgedcloudwhitenote">'''Analyze:'''<br>Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.<br>It will provide the following phrase:<br>First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...<br>Third Person: Drawing his fingers through the air, Player's movements gradually become sluggish as he finishes the somatic components of his spell.<br>Hidden or Invisible:<br>Specific Spell Restriction: 504<br><br>'''Show:'''<br>This paper looks interesting... perhaps you should read it.</div> |
|||
| 750 |
|||
|- |
|- |
||
|} |
|||
| a jet of yellow fire charm ||'''yellow |
|||
</blockquote> |
|||
|- |
|||
<!-- Other Rooms Here --> |
|||
| a phoenix flame charm || rowspan=3| [[Minor Fire (906)]] || You summon flame-wrought semblance of a '''{phoenix}''' at a giant rat!<br>Person summons flame-wrought semblance of a '''{phoenix}''' at a giant rat! |
|||
<section end=current /> |
|||
|- |
|||
| a dragon flame charm || '''dragon |
|||
|- |
|||
| a drake flame charm || '''drake |
|||
|- |
|||
|} |
|||
{{Container| |
|||
|container=In the willow receptacle you see:}} |
|||
{| {{prettytable|font-size:95%}} |
|||
| a geyser token ||rowspan=3| [[Minor Water (903)]] || You direct a geyser of water at a giant rat!<br>Person directs a geyser of water at a giant rat! |
|||
|- |
|||
| a wave token || You summon a small wave of water at a giant rat!<br>Person summons a small wave of water at a giant rat! |
|||
|- |
|||
| a vaporous rune token || You draw a fluid string of vaporous runes at a giant rat!<br>Person draws a fluid string of vaporous runes at a giant rat! |
|||
|- |
|||
|} </blockquote><section end=current /> |
|||
{{#section:BVShop:Spellbound/archive|archive}} |
{{#section:BVShop:Spellbound/archive|archive}} |
Revision as of 20:07, 13 February 2021
2021Q1
a narrow space between two buildings, [Map Room 3], Lich# 26877, go narrow space
Spellbound
[Spellbound - 26878] | |
With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. | |
Obvious exits: south, out |
dust-covered note
Items in the case are magical trinkets which automatically recharge daily: Green Mossbark Wand: Wild Entropy (603) - 40x/day White Ora Rod: Condemn (309) - 40x/day Twisted Crystal Wand: Phase (704) - 40x/day Earthen Brock Rock Trinket: Tremors (909) - 40x/day White Eonake Cross: Remove Curse (315) - 3x/day Golden Shield Pin: Mantle of Faith (1601) - 3x/day Blue Quartz Pin: Mindward (1208) - 1x/day Small Statue Clasp: Spirit Guard (1712) - 1x/day Shiny Gold Coin Pin: Arcane Decoy (1701) - 20x/day Green Leaf Symbol: Phoen's Strength (606) - 1x/day Shiny Knight Symbol: Dauntless (1606) - 1x/day Pearl-edged White Ora Cube: Benediction (307) - 1x/day Bright Yellow Potion Trinket: Adrenal Surge (1107) - 3x/day Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity. New potions on the shelf! The absinthe green tincture significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The pearlescent purple philter significantly increases one's ensorcelling skill and comes with 1 dose. The blue-violet infusion significantly increases one's loresong unlocking skill and comes with 1 dose. Lastly, the dilute copper ayan'eth potions (8x), dilute silver ayan'eth potions (9x), and dilute golden ayan'eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.
In the sigil-incised display case you see: a blackened green mossbark wand, an elegant white ora rod, a twisted crystal wand, an earthen brown rock trinket, a gleaming white eonake cross, a dazzling golden shield pin, a blue quartz symbol, a small statue clasp, a shiny gold coin pin, a green leaf symbol, a metallic shiny knight symbol, a pearl-edged white ora cube engraved with variegated symbols and a bright yellow potion trinket.
a blackened green mossbark wand Weight: <1 pound Wild Entropy
40 charges
persists
wave activated10,000 an elegant white ora rod Weight: <1 pound Condemn
40 charges
persists
wave activated15,000 a twisted crystal wand Weight: <1 pound Phase
40 charges
persists
wave activated10,000 an earthen brown rock trinket Weight: <1 pound pin-worn
functionalTremors
40 charges
persists
rub activated20,000 a gleaming white eonake cross Weight: <1 pound pin-worn
functionalRemove Curse
3 charges
persists
rub activated15,000 a dazzling golden shield pin Weight: <1 pound pin-worn
functionalMantle of Faith
3 charges
persists
raise activated15,000 a blue quartz symbol Weight: <1 pound pin-worn
functionalMindward
1 charge
persists
raise activated15,000 a small statue clasp Weight: <1 pound pin-worn
functionalSpirit Guard
1 charge
persists
raise activated20,000 a shiny gold coin pin Weight: <1 pound pin-worn
functionalArcane Decoy
20 charges
persists
rub activated15,000 a green leaf symbol Weight: <1 pound pin-worn
functionalPhoen's Strength
1 charge
persists
raise activated15,000 a metallic shiny knight symbol Weight: <1 pound pin-worn
functionalDauntless
1 charge
persists
raise activated20,000 a pearl-edged white ora cube engraved with variegated symbols Weight: <1 pound pin-worn
functionalBenediction
1 charge
persists
raise activated15,000 a bright yellow potion trinket Weight: <1 pound pin-worn
functionalAdrenal Surge
3 charges
persists
rub activated15,000 In the rune-covered wooden crate you see: a heavy invar necklace set with square-cut rubies, a diamond-linked silver necklace dangling tiny sapphires and a twisted rose gold necklace accented with dark aquamarine rosettes.
a heavy invar necklace set with square-cut rubies Weight: <1 pound neck-worn Analyze:
You analyze the invar necklace and sense that the creator has provided the following information:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.
Examine:
The necklace is made from a perfect sphere of polished moonstone. Silver light shines out in a glimmering sliver from the stone, reflecting Liabo's current waxing crescent phase. A delicate setting of pure platinum holds the miniature moon.25,000 a diamond-linked silver necklace dangling tiny sapphires Weight: <1 pound neck-worn analyze, examineAnalyze:
You analyze the silver necklace and sense that the creator has provided the following information:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.
Examine:
The necklace is made from a perfectly spherical star ruby. Crimson light shines out in a glimmering sliver from the stone, reflecting Tilaok's current waxing crescent phase. The stone's star twinkles gently, brightening and dimming. An elegant setting of pure platinum holds the miniature moon.25,000 a twisted rose gold necklace accented with dark aquamarine rosettes Weight: <1 pound neck-worn analyze, examineAnalyze:
You analyze the rose gold necklace and sense that the creator has provided the following information:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.
Examine:
The necklace is made from a perfect sphere of polished opal. Pearlescent light shines out in a luminous crescent from the stone, reflecting Lornon's current first half phase. A simple setting of pure platinum holds the miniature moon.25,000 On the small round table you see: a smoke-tinted rolaren monocle, a rose-tinged bronze monocle, a silver squiggly-framed monocle and a filigreed gold-tinted monocle.
a smoke-tinted rolaren monocle Weight: <1 pound analyzeAnalyze:
You analyze the rolaren monocle and sense that the creator has provided the following information:
A smoke-tinted rolaren monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1,500 a rose-tinged bronze monocle Weight: <1 pound analyzeAnalyze:
You analyze the bronze monocle and sense that the creator has provided the following information:
A rose-tinged bronze monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1,500 a silver squiggly-framed monocle Weight: <1 pound analyzeAnalyze:
You analyze the squiggly-framed monocle and sense that the creator has provided the following information:
A silver squiggly-framed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1,500 a filigreed gold-tinted monocle Weight: <1 pound analyzeAnalyze:
You analyze the gold-tinted monocle and sense that the creator has provided the following information:
A filigreed gold-tinted monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1,500 On the dilapidated wooden shelf you see: a shimmering trinket, a smooth turquoise leather journal embossed with a peacock feather, an ivory suede-spined gold puma fur-covered ledger, a translucent gold and teal bottle, a twine-wrapped smoky grey jar, a gold-leafed shimmering pink bottle, a black-eyed skull-shaped jar, a shimmering certificate, a glittering ticket, a dilute golden ayan'eth potion, a dilute silver ayan'eth potion, a dilute copper ayan'eth potion, a pale blue-violet infusion, an absinthe green tincture and a pearlescent purple philter.
a shimmering trinket Weight: <1 pound pin-worn analyze, examineAnalyze:
The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.
It is not currently active, but is using set 1 (out of 1): nothing special at this time.
The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.
Examine:
A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.5,000 a smooth turquoise leather journal embossed with a peacock feather Weight: <1 pound analyzeAnalyze:
This leather journal is a heavily scripted fluff book. It can be altered freely so long as it remains a book.
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.
2,000 an ivory suede-spined gold puma fur-covered ledger Weight: <1 pound analyzeAnalyze:
This fur-covered ledger is a heavily scripted fluff book. It can be altered freely so long as it remains a book.
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.
2,000 a translucent gold and teal bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
50 items100 a twine-wrapped smoky grey jar Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
50 items100 a gold-leafed shimmering pink bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
100 items250 a black-eyed skull-shaped jar Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
100 items250 a shimmering certificate Weight: <1 pound analyze, examineAnalyze:
Your certificate is used to unlock the potential of things held in your other hand.
The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.
You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.
Your certificate may not be altered or changed in any way.
Examine:
You glance at the shimmering certificate.
You notice something written on it...
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.1,000 a glittering ticket Weight: <1 pound analyze, examineAnalyze:
Your ticket is used to unlock the potential of things held in your other hand.
The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.
Your ticket may not be altered or changed in any way.
Examine:
You glance at the glittering ticket.
You notice something written on it...
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).3,500 a dilute golden ayan'eth potion Weight: 2 pounds 30,000 a dilute silver ayan'eth potion Weight: 2 pounds 25,000 a dilute copper ayan'eth potion Weight: 2 pounds 20,000 a pale blue-violet infusion Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this infusion. A bard may be able to provide more specifics.10,000 an absinthe green tincture Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this tincture. A bard may be able to provide more specifics.50,000 a pearlescent purple philter Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this philter. A bard may be able to provide more specifics.50,000
a narrow space between two buildings, [Map Room #], Lich# 26878, south
Spellbound, Crevice
[Spellbound, Crevice - 26881] | |
Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. | |
Obvious exits: north |
On the dilapidated birch shelf you see: a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpsest and a thin shadowy black parchment.
a smooth off-white vellum Weight: <1 pound analyze, examineAnalyze:
Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your anthracite eyes flash with a holy light as you release the [Spell Name] spell...
Third Person: Cajoling the lesser spirits, Maetriks utters a lyrical prayer that is accompanied by simple gestures. Her anthracite eyes flash with a holy light as she releases her spell.
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.
Specific Spell Restriction: 103
Examine:
This paper looks interesting... perhaps you should read it.750 a translucent cream-hued vellum Weight: <1 pound analyze, examineAnalyze:
Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your anthracite eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...
Third Person: Closing her eyes tightly, Maetriks appears to be concentrating for several seconds as she murmurs a soft prayer to the spirits. As the last syllable falls from her lips, her anthracite eyes fly wide open and she flicks her fingers, releasing her spell.
Hidden or Invisible: Anthracite light suddenly flashes in the air.
Specific Spell Restriction: 116
Examine:
This paper looks interesting... perhaps you should read it.750 a silvery lightning-motif vellum Weight: <1 pound analyze, examineAnalyze:
Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your smooth, immaculately pallid skin as you release the stored energy of the [Spell Name] spell...
Third Person: Curling her fingers into claws, Maetriks forcefully confronts the spirits and demands that they mold themselves to her will. Zorchar energy crackles across the surface of her smooth, immaculately pallid skin as she releases the stored energy of her spell.
Hidden or Invisible: Zorchar energy crackles through the air.
Specific Spell Restriction: 125
Examine:
This paper looks interesting... perhaps you should read it.750 a small scale-shaped parchment Weight: <1 pound analyze, examineAnalyze:
Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...
Third Person: Sibilantly forming the simple words of her prayer, Maetriks implores shadows and darkness to protect her.
Hidden or Invisible: Sibilant prayers issue from the darkness.
Specific Spell Restriction: 303
Examine:
This paper looks interesting... perhaps you should read it.750 an inky black palimpsest Weight: <1 pound analyze, examineAnalyze:
Invoking this black palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your anthracite eyes and transforms into a [Spell Name] before you...
Third Person: Flexing her fingers slightly, Maetriks's form begins to darken and shadows seep from her anthracite eyes. Maetriks releases her spell by transforming that darkness around her into a spiritual shield.
Hidden or Invisible: Darkness briefly pools about the area.
Specific Spell Restriction: 202
Examine:
This paper looks interesting... perhaps you should read it.750 a thin shadowy black parchment Weight: <1 pound analyze, examineAnalyze:
Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tenebrous shadows slip across your smooth, immaculately pallid skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...
Third Person: Tenebrous shadows slip across Maetriks's smooth, immaculately pallid skin as she demands divinity to heed her prayers. As if in answer, her anthracite eyes briefly blacken as she releases her fury.
Hidden or Invisible:
Specific Spell Restriction: 317
Examine:
This paper looks interesting... perhaps you should read it.750 On the decaying oaken slab you see: a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.
a coin-edged piece of sheet music Weight: <1 pound analyze, examineAnalyze:
Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Maetriks weaves the simple somatic components of a spell into the air.
Hidden or Invisible: Rising on the air is a familiar ditty.
Specific Spell Restriction: 403
Examine:
This paper looks interesting... perhaps you should read it.750 a sheet of watermarked music Weight: <1 pound analyze, examineAnalyze:
Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...
Third Person: Lifting her voice in song, Maetriks spins a quick tale involving a small child trying to discover the mysteries of water elementals. As she sings, she weaves her fingers in a complicated pattern that mimics the cadence of her tune and in the process, casts a spell.
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.
Specific Spell Restriction: 405
Examine:
This paper looks interesting... perhaps you should read it.750 a violet cotton sheet Weight: <1 pound analyze, examineAnalyze:
Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing simple lines upon your smooth, immaculately pallid brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third anthracite eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...
Third Person: Tracing simple lines upon her smooth, immaculately pallid brow, Maetriks invokes the elements and almost instantly a third anthracite eye opens in her forehead. Seconds after she releases the spell, the eye fades away.
Hidden or Invisible:
Specific Spell Restriction: 416
Examine:
This paper looks interesting... perhaps you should read it.750 a soft sigil-etched sheet Weight: <1 pound analyze, examineAnalyze:
Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Maetriks invokes the elements as she casts her spell.
Hidden or Invisible:
Specific Spell Restriction: 419
Examine:
This paper looks interesting... perhaps you should read it.750 a whorl-edged cloud white note Weight: <1 pound analyze, examineAnalyze:
Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...
Third Person: Drawing her fingers through the air, Maetriks's movements gradually become sluggish as she finishes the somatic components of her spell.
Hidden or Invisible:
Specific Spell Restriction: 504
Examine:
This paper looks interesting... perhaps you should read it.750
2020Q3
narrow space between two buildings, [Map Room #16], Lich# 26877, go narrow space
Spellbound
[Spellbound - 26878] | |
With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a wave-painted brick door. | |
Obvious exits: south, out |
dust-covered note
Items in the case are magical trinkets which automatically recharge daily: Gold Coin Pin: Arcane Decoy (1701) - 20x/day Wizard Hat Symbol: Mage Armor (520) - 1x/day Twisted Twig Trinket: Self Control (613) - 1x/day Prismatic Clasp: Prismatic Guard (905) - 3x/day Cloak Clasp: Cloak of Shadows (712) - 1x/day Curved Sigil: Elemental Bias (508) - 1x/day Square Stickpin: Prayer (313) - 1x/day Shiny Knight Symbol: Dauntless (1606) - 1x/day Citrine Quartz Pin: Fash'lo'nae's Gift (1750) - 1x/day Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity. New potions on the shelf! The viscous opalescent brew significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The draught significantly increases one's ensorcelling skill and comes with 1 dose. The cordial significantly increases one's loresong unlocking skill and comes with 1 dose. Lastly, the dilute copper ayan'eth potions (8x), dilute silver ayan'eth potions (9x), and dilute golden ayan'eth potions (10x) are for pretempering to enchant items to much higher than normal levels (8-10x) and come with 5 doses each.
In the sigil-incised display case you see: a shiny gold coin pin, a small wizard hat symbol, a small twisted twig trinket, a smooth prismatic clasp, a dark cloak clasp, a silvery curved sigil, a white square stickpin and a metallic shiny knight symbol.
a shiny gold coin pin Weight: <1 pound pin-worn
functionalArcane Decoy
20 charges15000 a small wizard hat symbol Weight: <1 pound pin-worn
functionalMage Armor
1 charge20000 a small twisted twig trinket Weight: <1 pound pin-worn
functionalSelf Control
1 charge20000 a smooth prismatic clasp Weight: <1 pound pin-worn
functionalPrismatic Guard
3 charges15000 a dark cloak clasp Weight: <1 pound pin-worn
functionalCloak of Shadows
1 charge20000 a silvery curved sigil Weight: <1 pound pin-worn
functionalElemental Bias
1 charge20000 a white square stickpin Weight: <1 pound pin-worn
functionalPrayer
1 charge20000 a metallic shiny knight symbol Weight: <1 pound pin-worn
functionalDauntless
1 charge20000 a slit-pupiled citrine quartz pin Weight: <1 pound pin-worn
functionalFash'lo'nae's Gift
1 charge100000 Under the sigil-incised display case you see: a blackened silver necklace set with an orb-caged white pearl, an oval-linked electrum necklace set with a cylinder-caged crimson blazestar and a slender vaalin necklace set with a square-caged silver starstone.
a blackened silver necklace set with an orb-caged white pearl Weight: <1 pound neck-worn analyzeAnalyze:
You analyze the silver necklace and sense that the creator has provided the following information:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.25000 an oval-linked electrum necklace set with a cylinder-caged crimson blazestar Weight: <1 pound neck-worn analyzeAnalyze:
You analyze the electrum necklace and sense that the creator has provided the following information:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.25000 a slender vaalin necklace set with a square-caged silver starstone Weight: <1 pound neck-worn analyzeAnalyze:
You analyze the vaalin necklace and sense that the creator has provided the following information:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.25000 On the small round table you see: a violet-tinted electrum monocle, a reflective gold-rimmed monocle, a bent-framed brass monocle and a heavy invar monocle.
a violet-tinted electrum monocle Weight: <1 pound analyzeAnalyze:
You analyze the electrum monocle and sense that the creator has provided the following information:
A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1500 a reflective gold-rimmed monocle Weight: <1 pound analyzeAnalyze:
You analyze the gold-rimmed monocle and sense that the creator has provided the following information:
A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1500 a bent-framed brass monocle Weight: <1 pound analyzeAnalyze:
You analyze the brass monocle and sense that the creator has provided the following information:
A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1500 a heavy invar monocle Weight: <1 pound Analyze:
You analyze the invar monocle and sense that the creator has provided the following information:
A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
1500 On the dilapidated wooden shelf you see: a shimmering trinket, a dog-eared brown suede tome, an immaculate white leather codex, a bulbous vibrant crimson bottle, a gold-caged lustrous green jar, a silver-chased dark purple bottle, a squat pale pink jar, a shimmering certificate, a glittering ticket, a dilute golden ayan'eth potion, a dilute silver ayan'eth potion, a dilute copper ayan'eth potion, a foamy amber cordial, a viscous opalescent brew and a bubbling bright green draught.
a shimmering trinket Weight: <1 pound pin-worn analyze, examineAnalyze:
The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.
It is not currently active, but is using set 1 (out of 1): nothing special at this time.
The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.
Examine:
A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.5000 a dog-eared brown suede tome Weight: <1 pound analyzeAnalyze:
This brown suede tome is a heavily scripted fluff book. It can be altered freely so long as it remains a book.
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.
2000 an immaculate white leather codex Weight: <1 pound analyzeAnalyze:
This white leather codex is a heavily scripted fluff book. It can be altered freely so long as it remains a book.
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.
2000 a bulbous vibrant crimson bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
50 items100 a gold-caged lustrous green jar Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
50 items100 a silver-chased dark purple bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
100 items250 a squat pale pink jar Weight: <1 pound
Pocketed: Very small (<2-4)
one itemAlchemy jar
100 items250 a shimmering certificate Weight: <1 pound analyze, examineAnalyze:
Your certificate is used to unlock the potential of things held in your other hand.
The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.
You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.
Your certificate may not be altered or changed in any way.
Examine:
As you glance over the certificate you notice something written on it...
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.1000 a glittering ticket Weight: <1 pound analyze, examineAnalyze:
Your ticket is used to unlock the potential of things held in your other hand.
The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.
Your ticket may not be altered or changed in any way.
Examine:
As you glance over the ticket you notice something written on it...
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).3500 a dilute golden ayan'eth potion Weight: 2 pounds 30000 a dilute silver ayan'eth potion Weight: 2 pounds 25000 a dilute copper ayan'eth potion Weight: 2 pounds 20000 a foamy amber cordial Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this cordial. A bard may be able to provide more specifics.10000 a viscous opalescent brew Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.50000 a bubbling bright green draught Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught. A bard may be able to provide more specifics.50000
, [Map Room #], Lich# 26878, south
Spellbound, Crevice
[Spellbound, Crevice - 26881] | |
Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. | |
Obvious exits: north |
On the dilapidated birch shelf you see: a smooth off-white vellum, a translucent cream-hued vellum, a silvery lightning-motif vellum, a small scale-shaped parchment, an inky black palimpest and a thin shadowy black parchment.
a smooth off-white vellum Weight: <1 pound analyze, examineAnalyze:
Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your umber eyes flash with a holy light as you release the [Spell Name] spell...
Third Person: Cajoling the lesser spirits, Xanlin utters a lyrical prayer that is accompanied by simple gestures. His umber eyes flash with a holy light as he releases his spell.
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.
Specific Spell Restriction: 103
Examine:
This paper looks interesting... perhaps you should read it.750 a translucent cream-hued vellum Weight: <1 pound analyze, examineAnalyze:
Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your umber eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...
Third Person: Closing his eyes tightly, Xanlin appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his umber eyes fly wide open and he flicks his fingers, releasing his spell.
Hidden or Invisible: Umber light suddenly flashes in the air.
Specific Spell Restriction: 116
Examine:
This paper looks interesting... perhaps you should read it.750 a silvery lightning-motif vellum Weight: <1 pound analyze, examineAnalyze:
Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your sun-kissed, lightly freckled skin as you release the stored energy of the [Spell Name] spell...
Third Person: Curling his fingers into claws, Xanlin forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar energy crackles across the surface of his sun-kissed, lightly freckled skin as he releases the stored energy of his spell.
Hidden or Invisible: Zorchar energy crackles through the air.
Specific Spell Restriction: 125
Examine:
This paper looks interesting... perhaps you should read it.750 a small scale-shaped parchment Weight: <1 pound analyze, examineAnalyze:
Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...
Third Person: Sibilantly forming the simple words of his prayer, Xanlin implores shadows and darkness to protect him.
Hidden or Invisible: Sibilant prayers issue from the darkness.
Specific Spell Restriction: 303
Examine:
This paper looks interesting... perhaps you should read it.750 an inky black palimpest Weight: <1 pound analyze, examineAnalyze:
Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your umber eyes and transforms into a [Spell Name] before you...
Third Person: Flexing his fingers slightly, Xanlin's form begins to darken and shadows seep from his umber eyes. Xanlin releases his spell by transforming that darkness around him into a spiritual shield.
Hidden or Invisible: Darkness briefly pools about the area.
Specific Spell Restriction: 202
Examine:
This paper looks interesting... perhaps you should read it.750 a thin shadowy black parchment Weight: <1 pound analyze, examineAnalyze:
Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tenebrous shadows slip across your sun-kissed, lightly freckled skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...
Third Person: Tenebrous shadows slip across Xanlin's sun-kissed, lightly freckled skin as he demands divinity to heed his prayers. As if in answer, his umber eyes briefly blacken as he releases his fury.
Hidden or Invisible:
Specific Spell Restriction: 317
Examine:
This paper looks interesting... perhaps you should read it.750 On the decaying oaken slab you see: a coin-edged piece of sheet music, a sheet of watermarked music, a violet cotton sheet, a soft sigil-etched sheet and a whorl-edged cloud white note.
a coin-edged piece of sheet music Weight: <1 pound analyze, examineAnalyze:
Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Xanlin weaves the simple somatic components of a spell into the air.
Hidden or Invisible: Rising on the air is a familiar ditty.
Specific Spell Restriction: 403
Examine:
This paper looks interesting... perhaps you should read it.750 a sheet of watermarked music Weight: <1 pound analyze, examineAnalyze:
Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...
Third Person: Lifting his voice in song, Xanlin spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.
Specific Spell Restriction: 405
Examine:
This paper looks interesting... perhaps you should read it.750 a violet cotton sheet Weight: <1 pound analyze, examineAnalyze:
Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing simple lines upon your sun-kissed, lightly freckled brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third umber eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...
Third Person: Tracing simple lines upon his sun-kissed, lightly freckled brow, Xanlin invokes the elements and almost instantly a third umber eye opens in his forehead. Seconds after he releases the spell, the eye fades away.
Hidden or Invisible:
Specific Spell Restriction: 416
Examine:
This paper looks interesting... perhaps you should read it.750 a soft sigil-etched sheet Weight: <1 pound analyze, examineAnalyze:
Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Xanlin invokes the elements as he casts his spell.
Hidden or Invisible:
Specific Spell Restriction: 419
Examine:
This paper looks interesting... perhaps you should read it.750 a whorl-edged cloud white note Weight: <1 pound analyze, examineAnalyze:
Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...
Third Person: Drawing his fingers through the air, Xanlin's movements gradually become sluggish as he finishes the somatic components of his spell.
Hidden or Invisible:
Specific Spell Restriction: 504
Examine:
This paper looks interesting... perhaps you should read it.750
Previous Inventory
Spellbound
a narrow space between two buildings, Map Room 16, Lich #26878, go narrow space
Spellbound
[Spellbound - 26878] | |
With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. | |
Obvious exits: south, out |
Spell preps! In crate: Circles 100-400 Behind brick: Circles 500-900 On brick: Circles 1000-1700, and ALL casting Please READ each paper to see specific restrictions. The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, a certificate to increase its maximum charges by 1, and a ticket to add 1 appearance set. Each charge lasts 1 month, and the trinket can be recharged by monks and recharging merchants. Items in the case are magical trinkets which automatically recharge daily: Deathstone Pin: Spirit Strike (117) - 2x/day Heroic Knight Clasp: Heroism (215) - 1x/day Green Leaf Symbol: Phoen's Strength (606) - 1x/day Sickly Green Sigil: Pestilence (716) - 3x/day Green Wavy Symbol: Mass Blur (911) - 1x/day Yellow Smooth Cylinder: Arm of the Arkati (1605) - 1x/day Wrapped Hand Symbol: Brace (1214) - 1x/day Dark Purple Amethyst Pendant: Empathic Focus (1109) - 1x/day Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity. New potions on the shelf! The wispy orange brew significantly increases one's enchanting skill and comes with 1 dose (old style Enchanting only!). The viscous opalescent brew significantly increases one's enchanting skill and comes with 5 doses (new style Enchanting only!). The draught significantly increases one's ensorcelling skill and comes with 1 dose. Lastly, the bromin (8x), aleteh (9x), and grenshol (10x) potions are for pretempering to enchant items to much higher than normal levels (8-10x).
In the sigil-incised display case you see:
a black deathstone pin Weight: <1 pound pin-worn
functional analyze, imbedAnalyze:
This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.
Imbed:
Spirit Strike
2 charges
rubbing activated
persists10000 a heroic knight clasp Weight: <1 pound pin-worn
functional analyze, imbed20000 a green leaf symbol Weight: <1 pound pin-worn
functional analyze, imbedAnalyze:
This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.
Imbed:
Phoen's Strength
1 charge
raising activated
persists15000 a sickly green sigil Weight: <1 pound pin-worn
functional analyze, imbedAnalyze:
This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.
Imbed:
Pestilence
3 charges
raising activated
persists10000 a green wavy symbol Weight: <1 pound pin-worn
functional analyze, imbed10000 a yellow smooth cylinder Weight: <1 pound pin-worn
functional analyze, imbedAnalyze:
This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.
Imbed:
Arm of the Arkati
1 charge
raising activated
persists10000 a small wrapped hand symbol Weight: <1 pound pin-worn
functional analyze, imbed20000 a dark purple amethyst pendant Weight: <1 pound pin-worn
functional analyze, imbedAnalyze:
This is a magical item that has some special properties. Casting Elemental Detection (spell 405) will offer more information.
Imbed:
Empathic Focus
1 charge
raising activated
persists100000 Under the sigil-incised display case you see:
a blackened silver necklace set with an orb-caged white pearl Weight: <1 pound neck-worn analyzeAnalyze:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.25000 an oval-linked electrum necklace set with a cylinder-caged crimson blazestar Weight: <1 pound neck-worn analyze, show descriptionAnalyze:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.
Show:
The necklace is made from a perfectly spherical star ruby. The crimson stone is a dark shade of red-black, reflecting Tilaok's current new moon phase. Even the stone's star is dim. An elegant setting of pure platinum holds the miniature moon.25000 a slender vaalin necklace set with a square-caged silver starstone Weight: <1 pound neck-worn analyze, show descriptionAnalyze:
This necklace was originally released during the auction of 5100. Current verbs are LOOK and SHOW.
Show:
The necklace is made from a perfect sphere of polished moonstone. The silvery stone is a dark shade of grey, reflecting Liabo's current new moon phase. A delicate setting of pure platinum holds the miniature moon.25000 In the rune-covered wooden crate you see:
a jewel-toned striped paper Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this striped paper will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Grating out a request to the nearby spirits, you leech upon their power for [Spell Name], your veins light up with a dim luminescence.
Third Person: Grating out an incomprehensible phrase, Player's eyes flash with power, his veins lighting up with a dim luminescence.
Hidden or Invisible: A dim luminescence glows briefly in the shape of a figure, then disappears.
Specific Spell Restriction: 103
Show:
This paper looks interesting... perhaps you should read it.750 a finely scripted palimpsest Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this scripted palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Murmuring an incantation for [Spell Name], you momentarily feel as if you are flying through the stars, darkness pressing in on you.
Third Person: Player's eyelids flicker rapidly and a star-pricked darkness flows across his skin as he murmurs a magical incantation.
Hidden or Invisible: You hear soft murmuring.
Specific Spell Restriction: 116
Show:
This paper looks interesting... perhaps you should read it.750 a sun-embossed golden parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this golden parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tendrils of darksome mist gather about you, swirling upwards, as you beseech the lesser spirits for aid with the [Spell Name] spell...
Third Person: Tendrils of darksome mist gather about Player, swirling upwards as he beseeches the lesser spirits for aid...
Hidden or Invisible: You hear someone beseeching the lesser spirits for aid.
Specific Spell Restriction: 125
Show:
This paper looks interesting... perhaps you should read it.750 a silver-inked ebon paper Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this ebon paper will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Motes of pearly light dance across your fingers and splay out around you as you quietly, lullingly, whisper the incantation for [Spell Name].
Third Person: While Player whispers quietly, lullingly, motes of pearly light dance across his fingers and splay out around him.
Hidden or Invisible: Motes of pearly light dance through the air as quiet, lulling whispering floats through the area.
Specific Spell Restriction: 202
Show:
This paper looks interesting... perhaps you should read it.750 a creased powder blue palimpsest Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this powder blue palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Preparing [Spell Name], you solicit the spirits with a casual flick of the hand, and tendrils of sanguine thread appear, then wrap around your hand in an agonizingly painful bind before they fade away.
Third Person: Player casually flicks his hand, tendrils of sanguine thread appearing and then wrapping tightly around it before they fade away.
Hidden or Invisible: Tendrils of sanguine threading appear in the air, then move in an odd but clearly regular pattern before fading away.
Specific Spell Restriction: 214
Show:
This paper looks interesting... perhaps you should read it.750 a heart-stamped bright salmon paper Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this bright salmon paper will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: As you gaze off into the distance, concentrating on the thought of a simple litany for [Spell Name], gently flowing wisps of mist rise up and circle around you.
Third Person: Player gazes off into the distance, and gently flowing wisps of mist rise up and circle around him.
Hidden or Invisible: Gently flowing wisps of mist rise up and float in a circular motion.
Specific Spell Restriction: 303
Show:
This paper looks interesting... perhaps you should read it.750 a midnight blue-starred parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this blue-starred parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Platinum energy streaks through your body, your veins and eyes glowing brightly as you growl a violent prayer for [Spell Name].
Third Person: Platinum energy streaks through Player's body, his veins and eyes glowing brightly as he growls a violent prayer.
Hidden or Invisible: Platinum energy streaks through the air in an odd pattern as a violent prayer pierces the air.
Specific Spell Restriction: 317
Show:
This paper looks interesting... perhaps you should read it.750 a hideous lumpy brown scroll Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this lumpy brown scroll will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: As you gesture precise movements for the [Spell Name] spell, your fingers transform into elongated objects before returning to their original shape...
Third Person: Player gestures precise movements, and for a moment, his fingers transform into elongated objects.
Hidden or Invisible:
Specific Spell Restriction: 403
Show:
This paper looks interesting... perhaps you should read it.750 an ale-stained half-bound scroll Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this half-bound scroll will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Murmuring a soothing invocation for [Spell Name], bright arcs of elemental energy spark around you as you pull on their power.
Third Person: Murmuring a soothing invocation, bright arcs of elemental energy spark around Player.
Hidden or Invisible: Bright arcs of elemental energy spark through the air.
Specific Spell Restriction: 405
Show:
This paper looks interesting... perhaps you should read it.750 a wide-striped blue and gold palimpsest Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this blue and gold palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: You close your eyes and twin beams of violet light issue from your illuminated eye sockets as you invoke the powers of the elements for the [Spell Name] spell...
Third Person: Player closes his eyes and twin beams of violet light issue from his illuminated eye sockets as he invokes the powers of the elements.
Hidden or Invisible: You hear someone invoking the powers of the elements.
Specific Spell Restriction: 416
Show:
This paper looks interesting... perhaps you should read it.750 an ink-blotted coppery papyrus Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this coppery papyrus will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: You draw an abstruse sigil for [Spell Name] in the air with your fingers, and brilliant light swirls up out of your pores.
Third Person: Player draws an abstruse sigil in the air with his fingers, and brilliant light swirls up out of his pores.
Hidden or Invisible: Brilliant light swirls around the area.
Specific Spell Restriction: 419
Show:
This paper looks interesting... perhaps you should read it.750 On the brick you see:
a frayed-edge ivory vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this ivory vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Breaking into a tortured song for [Spell Name], you focus on crafting a tune rife with loathing and distress.
Third Person: Player breaks into a tortured song, crafting a tune rife with loathing and distress.
Hidden or Invisible: A tortured song drifts through the area, its tune rife with loathing and distress.
Specific Spell Restriction: 1001
Show:
This paper looks interesting... perhaps you should read it.750 a hastily scrawled papyrus Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this scrawled papyrus will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Drawing in a long breath to prepare [Spell Name], you eke out an off-key melody fit for shattering glass, and a sharp pain stabs your mind.
Third Person: Player draws in a long breath, his expression suddenly pained as he ekes out an off-key melody fit for shattering glass.
Hidden or Invisible: An off-key melody fit for shattering glass fills the air.
Specific Spell Restriction: 1019
Show:
This paper looks interesting... perhaps you should read it.750 an onyx-dusted pristine white palimpsest Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this pristine white palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: You close your eyes and focus on [Spell Name], envPlayering how your limbs' anatomical structure -- the tendons, muscles, bones, blood vessels -- all work together in perfect harmony.
Third Person: Player closes his eyes, and the skin on his limbs briefly fades to translucency, the anatomical structure -- the tendons, muscles, bones, blood vessels -- visible for a mere moment.
Hidden or Invisible:
Specific Spell Restriction: 1102
Show:
This paper looks interesting... perhaps you should read it.750 a wax-crusted pale violet scroll Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this pale violet scroll will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: As you raise your hands up to prepare the [Spell Name] spell and insistently beckon several spirits to you, the faint outlines of their caliginous shadows flutter in and out of sight.
Third Person: The faint outlines of caliginous shadows flutter in and out of sight around Player as he raises his hands in an insistently beckoning manner.
Hidden or Invisible: The faint outlines of caliginous shadows flutter in and out of sight.
Specific Spell Restriction: 1115
Show:
This paper looks interesting... perhaps you should read it.750 a beige flower-pressed vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this flower-pressed vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Crooning the [Spell Name] spell in an archaic tongue, you focus on the passage of time, quickly shuttering the past and the present away.
Third Person: As Player croons an archaic phrase, he stares off into the distance, his eyes briefly turning to pools of marbled argent.
Hidden or Invisible: You hear soft crooning sounds.
Specific Spell Restriction: 1204
Show:
This vellum looks interesting... perhaps you should read it.750 a mossy green folded parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this green folded parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Clearing your mind of all but the [Spell Name] spell, you touch the tips of your fingers together and focus on the single thought of terrible pain slicing outward from them.
Third Person: Player touches the tips of his fingers together, a cruel expression flitting across his features.
Hidden or Invisible:
Specific Spell Restriction: 1210
Show:
This paper looks interesting... perhaps you should read it.750 a stained tart-stamped scroll Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this tart-stamped scroll will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Calling forth the [Spell Name] spell with the intonation of a single syllable, a murky shroud peels away from you and vanishes.
Third Person: As Player intones a spell with a single syllable, a murky shroud peels away from him and vanishes.
Hidden or Invisible: You hear a single intoned syllable.
Specific Spell Restriction: 1606
Show:
This paper looks interesting... perhaps you should read it.750 an iridescent tangerine papyrus Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this tangerine papyrus will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Waves of argentine light curl around you, embracing and seeping into you as you call upon your patron for [Spell Name].
Third Person: Waves of argentine light curl around Player, embracing and seeping into him as he calls upon his patron.
Hidden or Invisible: Waves of argentine light appear to curl through the air until they disappear.
Specific Spell Restriction: 1615
Show:
This paper looks interesting... perhaps you should read it.750 an embossed clover green vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this clover green vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: A haze of noxious vapor forms in the air overhead as you recite the esoteric command for [Spell Name]...
Third Person: A haze of noxious vapor forms in the air overhead as Player recites an esoteric command.
Hidden or Invisible: You hear someone reciting an esoteric command.
Specific Spell Restriction: 109
Show:
This paper looks interesting... perhaps you should read it.750 a translucent alabaster vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this alabaster vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: A haze of black mist gathers around you as you prepare [Spell Name]...
Third Person: A haze of black mist gathers around Player as he prepares a spell...
Hidden or Invisible: A haze of black mist appears and slowly dissipates.
Show:
This paper looks interesting... perhaps you should read it.750 a cat paw-printed paper Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this paw-printed paper will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Wisps of crimson light materialize in your palms, slowly floating into the air and disappearing as you chant the phrase for [Spell Name]...
Third Person: Wisps of crimson light materialize in Player's palms, slowly floating into the air and disappearing as he chants a phrase...
Hidden or Invisible: Wisps of crimson light float into the air.
Show:
This paper looks interesting... perhaps you should read it.750 Behind the brick you see:
a wavy-edged azure vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this azure vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Swiping your hand emphatically through the air, you deliberately slow its motion as you finish the stylized gesture for the [Spell Name] spell.
Third Person: Player swipes his hand emphatically through the air, his motion slowing significantly as he finishes the stylized gesture.
Hidden or Invisible:
Specific Spell Restriction: 504
Show:
This paper looks interesting... perhaps you should read it.750 a gold-inked dark burgundy parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this dark burgundy parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Barking an order at the ground below you to prepare the [Spell Name] spell, you feel it respond with a light tremble that sends a jolt of elemental energy racing through you.
Third Person: Player barks an order at the ground below him, and it trembles lightly in response.
Hidden or Invisible: The ground trembles lightly.
Specific Spell Restriction: 514
Show:
This paper looks interesting... perhaps you should read it.750 a leaf-shaped pale green paper Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this pale green paper will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: You envPlayer a forest growing up around you, evergreen trees bending down toward you to listen to your incantation of [Spell Name].
Third Person: For just a moment, Player appears to be surrounded by evergreen trees bending toward him to listen to his magical incantation.
Hidden or Invisible:
Specific Spell Restriction: 605
Show:
This paper looks interesting... perhaps you should read it.750 a neat aquamarine papyrus Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this aquamarine papyrus will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: As you quickly call forth the [Spell Name] spell, variegated pale turquoise light encompasses your hands.
Third Person: As Player chants a magical phrase, variegated pale turquoise light encompasses his hands.
Hidden or Invisible: Variegated pale turquoise light briefly lights up the area.
Specific Spell Restriction: 619
Show:
This paper looks interesting... perhaps you should read it.750 a simple light grey scroll Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this light grey scroll will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Your body flushes with a blood red hue, your veins standing out from your skin, as you incant a mantra for [Spell Name].
Third Person: Player's body flushes a blood red hue, his veins standing out from his skin and twisting his features, as he incants a mantra.
Hidden or Invisible: You hear a quiet incantation.
Specific Spell Restriction: 701
Show:
This paper looks interesting... perhaps you should read it.750 a neatily creased parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this creased parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: The flesh of your fingers blackens as you breathe in deeply, blood seeping out around your knuckles, then returns to normal as you focus on preparing [Spell Name].
Third Person: The flesh of Player's fingers blackens, blood seeping out around his knuckles as he breathes in deeply, then returns to normal.
Hidden or Invisible:
Specific Spell Restriction: 712
Show:
This paper looks interesting... perhaps you should read it.750 a blue-inked deep tan papyrus Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this deep tan papyrus will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: The whites of your eyes glow a luminous green around the black depths of your pupils as you forcefully invoke [Spell Name]...
Third Person: The whites of Player's eyes glow a luminous green around the black depths of his pupils as he forcefully invokes a spell.
Hidden or Invisible: You hear someone forcefully invoking a spell.
Specific Spell Restriction: 713
Show:
This paper looks interesting... perhaps you should read it.750 a ragged and stained paper Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this stained paper will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Your eyes roll back into your head and your body heaves spasmodically as the invocation of the [Spell Name] spell issues from the rictus of your gaping mouth...
Third Person: Player's eyes roll back into his head and his body heaves spasmodically as an invocation issues from his gaping mouth.
Hidden or Invisible: You hear someone invoking a spell.
Specific Spell Restriction: 725
Show:
This paper looks interesting... perhaps you should read it.750 a scalloped light yellow vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this light yellow vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: You feel energy ripple around you in chaotic waves, and you yank it toward you as you prepare the [Spell Name] spell.
Third Person: Player's eyes darken, then glow with chaotically shifting light, as he chants a magical phrase.
Hidden or Invisible: You hear someone chant a magical phrase.
Specific Spell Restriction: 905
Show:
This paper looks interesting... perhaps you should read it.750 a rolled and stamped palimpsest Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this stamped palimpsest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: As you draw heated power from the earth for the [Spell Name] spell, bits of flesh flake off of your skin, rising up into the air and turning to brightly burning cinders that whirl around you.
Third Person: Bits of flesh flake off of Player's skin, rising up into the air and turning to brightly burning cinders that whirl around him.
Hidden or Invisible: Brightly burning cinders whirl through the air.
Specific Spell Restriction: 917
Show:
This paper looks interesting... perhaps you should read it.750 a soot-dusted yellowing parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this yellowing parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: A great mass of turbulent air roils before you as you invoke the phrase for [Spell Name]...
Third Person: A great mass of turbulent air roils before Player as he invokes a magical phrase.
Hidden or Invisible: You hear someone invoking a magical phrase.
Specific Spell Restriction: 912
Show:
This paper looks interesting... perhaps you should read it.750 On the small round table you see:
a violet-tinted electrum monocle Weight: <1 pound analyzeAnalyze:
A violet-tinted electrum monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.1500 a reflective gold-rimmed monocle Weight: <1 pound analyzeAnalyze:
A reflective gold-rimmed monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.1500 a bent-framed brass monocle Weight: <1 pound analyzeAnalyze:
A bent-framed brass monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.1500 a heavy invar monocle Weight: <1 pound Analyze:
A heavy invar monocle is a religious item that is designed to allow the wearer to gaze at another person and discern the pantheon of that person's deity.
This ability can be blocked by unpresence. If not done while hidden or invisible, then the person that is gazed at will see a reflection of their deity's symbol in the monocle's lens.
USAGE: GAZE MY {MONOCLE} [AT {PLAYER}]
Additional USAGE: Exhale, Remove, Rub, Touch, Turn, and Wear
Turning the monocle allows it to be toggled to become hidden in your inventory and show up in your unique feature line. If it is not toggled, then it will show normally in the inventory line.
Currently, the monocle is not toggled and will be worn normally.
This monocle may be altered freely provided it stays with the noun of monocle, has a lens and metal frame.1500 On the dilapidated wooden shelf you see:
a viscous opalescent brew Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.50000 a grenshol potion Weight: 2 pounds 30000 an aleteh potion Weight: 2 pounds 25000 a bromin potion Weight: 2 pounds 20000 a wispy orange brew Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this brew. A bard may be able to provide more specifics.50000 a shimmering trinket Weight: <1 pound pin-worn analyze, show descriptionAnalyze:
The shimmering trinket is a "Shimmer Trinket", which can store the appearance of wearable items and project them over your normal clothing when it's worn. Just wear whatever items you want in whatever order you desire, then ATTEND the trinket. Once worn, it will only display those items while concealing all others. You may also CLEAN it to remove the previously stored appearance. If it is deactivated due to running out of charges, after it is recharged, you may PROD it to turn it back on. TURN will enable/disable how exact of an item must match in your inventory to be used (for items that shift in description). PUSH will rotate between the available appearance sets.
It is not currently active, but is using set 1 (out of 1): nothing special at this time.
The trinket must be periodically recharged by casting Shroud of Deception (1212) at it or by merchants. A charge is depleted when the trinket is set to an appearance and every 30 days thereafter.
You can tell that the trinket is as light as it can get.
Show:
A soft shimmer resonates through the trinket, making it appear to be every color and yet no color at all.5000 a bubbling bright green draught Weight: <1 pound analyzeAnalyze:
Once consumed, it will provide an effect that lasts for 5 minutes or until the next successful cast/attempt to boost your skill when performing the ability associated with this draught. A bard may be able to provide more specifics.50000 a dog-eared brown suede tome Weight: <1 pound analyzeAnalyze:
This brown suede tome is a heavily scripted fluff book. It can be altered freely so long as it remains a book.
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.
Try as you might, you cannot get a good sense of whether or not the tome's pockets could get any deeper, but you can tell that the tome is as light as it can get.2000 an immaculate white leather codex Weight: <1 pound analyzeAnalyze:
This white leather codex is a heavily scripted fluff book. It can be altered freely so long as it remains a book.
Traps: CLEAN, CLENCH, SHUFFLE, FLIP, GAZE, HUG, WAVE, KISS, LICK, PLUCK, POKE, SHAKE
TURN, SCRATCH, RAISE, KNOCK, NOD, SLAP, TAP, and PUNCH.
Try as you might, you cannot get a good sense of whether or not the codex's pockets could get any deeper, but you can tell that the codex is as light as it can get.2000 a bulbous vibrant crimson bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one item analyzeAnalyze:
This vibrant crimson bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.
Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.
It can hold a maximum of 50 items. PUT items in to store them. SHAKE the bottle to get them back out.100 a gold-caged lustrous green jar Weight: <1 pound
Pocketed: Very small (<2-4)
one item analyzeAnalyze:
This lustrous green jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.
Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.
It can hold a maximum of 50 items. PUT items in to store them. SHAKE the jar to get them back out.100 a silver-chased dark purple bottle Weight: <1 pound
Pocketed: Very small (<2-4)
one item analyzeAnalyze:
This dark purple bottle is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.
Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.
It can hold a maximum of 100 items. PUT items in to store them. SHAKE the bottle to get them back out.250 a squat pale pink jar Weight: <1 pound
Pocketed: Very small (<2-4)
one item analyzeAnalyze:
This pale pink jar is designed to hold small, nearly identical items -- in particular, gems, alchemy ingredients other than critter skins, etc.
Alterations are permitted to the base description following the 15/15/15 rule in ALTER 2, provided that it continues to make sense that the contents would be identifiable without looking inside.
It can hold a maximum of 100 items. PUT items in to store them. SHAKE the jar to get them back out.250 a shimmering certificate Weight: <1 pound analyze, show descriptionAnalyze:
Your certificate is used to unlock the potential of things held in your other hand.
The shimmering certificate will add 1 current and maximum charge to an existing Shimmer Trinket.
You need only RAISE your certificate while holding a compatible piece of equipment in your other hand.
Your certificate may not be altered or changed in any way.
Show:
As you glance over the certificate you notice something written on it...
This shimmering certificate will add 1 maximum charge to an existing Shimmer Trinket.1000 a glittering ticket Weight: <1 pound analyze, show descriptionAnalyze:
Your ticket is used to unlock the potential of things held in your other hand.
The glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).
You need only RAISE your ticket while holding a compatible piece of equipment in your other hand.
Your ticket may not be altered or changed in any way.
Show:
As you glance over the ticket you notice something written on it...
This glittering ticket will add 1 appearance set to an existing Shimmer Trinket. No matter the number of total appearance sets, a trinket can only store the appearance of a set number of items, determined by the number of items in your largest set times the number of sets, up to 100. i.e. you can have 5 sets with 20 items each, but if one set has 21 items, you can then only have 4 sets (since 5 x 21 = 105, which is greater than 100, so not possible).3500
crevice, Lich# 26878, south
Spellbound, Crevice
[Spellbound, Crevice - 26881] | |
Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. | |
Obvious exits: north |
On the dilapidated birch shelf you see:
a smooth off-white vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this off-white vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your blue-grey eyes flash with a holy light as you release the [Spell Name] spell...
Third Person: Cajoling the lesser spirits, Player utters a lyrical prayer that is accompanied by simple gestures. His blue-grey eyes flash with a holy light as he releases his spell.
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.
Specific Spell Restriction: 103
Show:
This paper looks interesting... perhaps you should read it.750 a translucent cream-hued vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this cream-hued vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your blue-grey eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...
Third Person: Closing his eyes tightly, Player appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his blue-grey eyes fly wide open and he flicks his fingers, releasing his spell.
Hidden or Invisible: Blue-grey light suddenly flashes in the air.
Specific Spell Restriction: 116
Show:
This paper looks interesting... perhaps you should read it.750 a silvery lightning-motif vellum Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this lightning-motif vellum will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your fair skin as you release the stored energy of the [Spell Name] spell...
Third Person: Curling his fingers into claws, Player forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar energy crackles across the surface of his fair skin as he releases the stored energy of his spell.
Hidden or Invisible: Zorchar energy crackles through the air.
Specific Spell Restriction: 125
Show:
This paper looks interesting... perhaps you should read it.750 a small scale-shaped parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this scale-shaped parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...
Third Person: Sibilantly forming the simple words of his prayer, Player implores shadows and darkness to protect him.
Hidden or Invisible: Sibilant prayers issue from the darkness.
Specific Spell Restriction: 303
Show:
This paper looks interesting... perhaps you should read it.750 an inky black palimpest Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this black palimpest will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your blue-grey eyes and transforms into a [Spell Name] before you...
Third Person: Flexing his fingers slightly, Player's form begins to darken and shadows seep from his blue-grey eyes. Player releases his spell by transforming that darkness around him into a spiritual shield.
Hidden or Invisible: Darkness briefly pools about the area.
Specific Spell Restriction: 202
Show:
This paper looks interesting... perhaps you should read it.750 a thin shadowy black parchment Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this shadowy black parchment will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tenebrous shadows slip across your fair skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vPlayer and you release your [Spell Name]...
Third Person: Tenebrous shadows slip across Player's fair skin as he demands divinity to heed his prayers. As if in answer, his blue-grey eyes briefly blacken as he releases his fury.
Hidden or Invisible:
Specific Spell Restriction: 317
Show:
This paper looks interesting... perhaps you should read it.750 On the decaying oaken slab you see:
a coin-edged piece of sheet music Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this piece of sheet music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Player weaves the simple somatic components of a spell into the air.
Hidden or Invisible: Rising on the air is a familiar ditty.
Specific Spell Restriction: 403
Show:
This paper looks interesting... perhaps you should read it.750 a sheet of watermarked music Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this watermarked music will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...
Third Person: Lifting his voice in song, Player spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.
Specific Spell Restriction: 405
Show:
This paper looks interesting... perhaps you should read it.750 a violet cotton sheet Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this cotton sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing simple lines upon your fair brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third blue-grey eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...
Third Person: Tracing simple lines upon his fair brow, Player invokes the elements and almost instantly a third blue-grey eye opens in his forehead. Seconds after he releases the spell, the eye fades away.
Hidden or Invisible:
Specific Spell Restriction: 416
Show:
This paper looks interesting... perhaps you should read it.750 a soft sigil-etched sheet Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this sigil-etched sheet will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Player invokes the elements as he casts his spell.
Hidden or Invisible:
Specific Spell Restriction: 419
Show:
This paper looks interesting... perhaps you should read it.750 a whorl-edged cloud white note Weight: <1 pound analyze, show descriptionAnalyze:
Invoking this cloud white note will grant you permanent access to a special method of preparing your spells.
It will provide the following phrase:
First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...
Third Person: Drawing his fingers through the air, Player's movements gradually become sluggish as he finishes the somatic components of his spell.
Hidden or Invisible:
Specific Spell Restriction: 504
Show:
This paper looks interesting... perhaps you should read it.750
Spellbound, 2018
Update: 12/20/18
a narrow space between two buildings, Lich #26878, Room 16, go narrow space
Spellbound Entry
[Spellbound] | |
With barely enough room to move around, this cramped space between the two buildings seems more like a trap than anything else. A small pile of crumbled cement has gathered on the floor beneath a brick that protrudes slightly from the wall. Trails of fresh rat droppings lead between a sigil-incised display case and a rune-covered wooden crate. You also see a dust-covered note, a dilapidated wooden shelf with some stuff on it, a wave-painted brick door and a small round table haphazardously draped with square cloths with some stuff on it. | |
Obvious exits: south, out |
On Shelf
The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, and a certificate to increase its maximum charges by 1. Each charge lasts for 1 month and the trinket can be recharged by monks and recharging merchants.
On the dilapidated wooden shelf you see:
a gold-banded short glass jar Pocketed: VSA (<2-4)
one itemalchemy jar, 100-count 250 a hexagonal golden glass bottle Pocketed: VSA (<2-4)
one itemalchemy jar, 100-count 250 a vaalin-banded square glass jar Pocketed: VSA (<2-4)
one itemalchemy jar, 50-count 100 a silver-hued tall glass bottle Pocketed: VSA (<2-4)
one itemalchemy jar, 50-count 100 a gold-spined thick leather codex heavily scripted book prop 2000 an enruned leather-bound tome heavily scripted book prop 2000 a shimmering trinket Shimmer Trinket, 3 charges 5000 a shimmering certificate Adds 1 maximum charge to a Shimmer Trinket 1000 a glittering ticket Adds 1 appearance set to a Shimmer Trinket 3500
On Table
New Edition! Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity.
On the small round table you see:
a sterling silver monocle Divine Monocles 1500 a simple copper monocle a polished golden monocle a rose-tinted brass monocle
In Case
In crate: Circles 100-400 Behind brick: Circles 500-900 On brick: Circles 1000-1700, and ALL casting Please READ each paper to see specific restrictions. The shelf holds a couple very zesty tomes, gem jars of both 50 and 100 count, a Shimmer Trinket that comes with 3 charges, a certificate to increase its maximum charges by 1, and a ticket to add 1 appearance set. Each charge lasts 1 month, and the trinket can be recharged by monks and recharging merchants. Behind the crate are multicast wands: Spiral crystal wand: Spirit (119), Elemental (417), and Mental Dispel (1218) - 5x/day Dark glass rod: Force Project (1207) and Telekinesis (1206) - 20x/day Luminescent baton: Elemental Defense I (401), II (406), and III (414) - 1x/day Deep blue baton: Spirit Warding I (101) and II (107) - 1x/day Items in the case are magical trinkets which automatically recharge daily: Shining knight pin: Bravery (211) - 1x/day Collection bowl trinket: Relieve Burden (314) - 1x/day Gleaming disk clasp: Floating Disk (511) - 1x/day Grasping arms stickpin - Grasp of the Grave (709) - 20x/day Red potion symbol: Heal II (806) - 5x Sigil-carved shield rune: Wizard's Shield (919) - 3x/day Chunk of petrified wyrwood: Strength of Will (1119) - 1x/day Iron shard pin: Iron Skin (1202) - 1x/day Silver shield symbol: Faith Shield (1619) - 3x/day Ominous cloud clasp: Death Cloud (1713) - 20x/day Items behind the case are illusion pins. The base item (only) can be freely altered by any willing merchant. These items can also be hidden using COVER while worn. New Edition! Divine Monocles allow you to see what pantheon your fellow adventurers are aligned with and for those trained in RELIGION LORE they will even give a glimpse of the adventurer's preferred deity.
In the sigil-incised display case you see:
an ominous cloud clasp Death Cloud (1713) pin-worn
functional15000 a gleaming silver shield symbol Faith Shield (1619) pin-worn
functional10000 a small iron shard pin Iron Skin (1202) pin-worn
functional10000 a chunk of petrified wyrwood Strength of Will (1119) pin-worn
functional15000 a sigil-carved shield rune Wizard's Shield (919) pin-worn
functional10000 a red potion symbol Heal II (806) pin-worn
functional10000 a grasping arms stickpin Grasp of the Grave (709) pin-worn
functional15000 a gleaming disk clasp Floating Disk (511) pin-worn
functional7500 a golden collection bowl trinket Relieve Burden (314) pin-worn
functional10000 a shining knight pin Bravery (211) pin-worn
functional15000
Under Case
Under the sigil-incised display case you see:
a white gold necklace dangling a platinum-caged moonstone MoonPhase Necklaces neck-worn 25000 a silver necklace dangling a platinum-caged star ruby a black steel necklace dangling a platinum-caged opal
Behind Case
Items behind the case are illusion pins. The base item (only) can be freely altered by any willing merchant. These items can also be hidden using COVER while worn.
The illusion relics are as follows: Steel-forged: Diagonal streaks of kohl black warpaint form a mask across his/her, the undulating design echoed along his/her forehead and chin. Gold: Sharp blackened sanguine-stained spikes protrude along the exposed skin of his/her body. Bone: His/Her face is enshrouded by a flickering skeletal visage. Serpentine: He/She has a fork-tongued green mist snake draped across his/her shoulders. Silver: Tiny mist-winged butterflies flutter about his/her form in a showcase of vibrant colors. Crow: An ethereal black mist crow perches upon his/her right shoulder, glancing about with shining red eyes.
Behind the sigil-incised display case you see:
a steel-forged relic Diagonal streaks of kohl black warpaint form a mask across his/her, the undulating design echoed along his/her forehead and chin. pin-worn 10000 a gold-spiked relic Sharp blackened sanguine-stained spikes protrude along the exposed skin of his/her body. pin-worn 10000 an onyx-veined bone relic cracked across the surface His/Her face is enshrouded by a flickering skeletal visage. pin-worn 10000 a serpentine relic He/She has a fork-tongued green mist snake draped across his/her shoulders. pin-worn 10000 a silver-edged relic Tiny mist-winged butterflies flutter about his/her form in a showcase of vibrant colors. pin-worn 10000 an alum crow relic An ethereal black mist crow perches upon his/her right shoulder, glancing about with shining red eyes. pin-worn 10000
Behind Crate
Behind the crate: Multi wand items, activated by raising, are back by popular demand! Spiral crystal wand: Spirit (119), Elemental (417), and Mental Dispel (1218) - 5x/day Dark glass rod: Force Project (1207) and Telekinesis (1206) - 20x/day Luminescent baton: Elemental Defense I (401), II (406), and III (414) - 1x/day Deep blue baton: Spirit Warding I (101) and II (107) - 1x/day
Behind the rune-covered wooden crate you see:
a long spiral crystal wand Spirit Dispel (119) Elemental Dispel (417) Mental Dispel (1218) 10000 a short dark glass rod Force Projection (1207) Telekinesis (1206) 15000 a small luminescent baton Elemental Defense I (401) Elemental Defense II (406) Elemental Defense III (414) 20000 a large deep blue baton Spirit Warding I (101) Spirit Warding II (107) 20000
In Crate
In crate: Circles 100-400
Spell preps all 750 BS
In the rune-covered wooden crate you see:
a marigold paint-spattered papyrus First Person: You draw an abstruse sigil for [Spell Name] in the air with your fingers, and brilliant light swirls up out of your pores.
Third Person: Person draws an abstruse sigil in the air with her fingers, and brilliant light swirls up out of her pores.
Hidden or Invisible: Brilliant light swirls around the area.
Specific Spell Restriction: 419a blue and jet dual-colored palimpsest First Person: You close your eyes and twin beams of violet light issue from your illuminated eye sockets as you invoke the powers of the elements for the [Spell Name] spell...
Third Person: Person closes her eyes and twin beams of violet light issue from her illuminated eye sockets as she invokes the powers of the elements.
Hidden or Invisible: You hear someone invoking the powers of the elements.
Specific Spell Restriction: 416a long violet-inked scroll First Person: Murmuring a soothing invocation for [Spell Name], bright arcs of elemental energy spark around you as you pull on their power.
Third Person: Murmuring a soothing invocation, bright arcs of elemental energy spark around Person.
Hidden or Invisible: Bright arcs of elemental energy spark through the air.
Specific Spell Restriction: 405a dark orange scroll First Person: As you gesture precise movements for the [Spell Name] spell, your fingers transform into elongated objects before returning to their original shape...
Third Person: Person gestures precise movements, and for a moment, her fingers transform into elongated objects.
Hidden or Invisible:
Specific Spell Restriction: 403an ebon-tined parchment First Person: Platinum energy streaks through your body, your veins and eyes glowing brightly as you growl a violent prayer for [Spell Name].
Third Person: Platinum energy streaks through Person's body, her veins and eyes glowing brightly as she growls a violent prayer.
Hidden or Invisible: Platinum energy streaks through the air in an odd pattern as a violent prayer pierces the air.
Specific Spell Restriction: 317a wide grey-dotted paper First Person: As you gaze off into the distance, concentrating on the thought of a simple litany for [Spell Name], gently flowing wisps of mist rise up and circle around you.
Third Person: Person gazes off into the distance, and gently flowing wisps of mist rise up and circle around her.
Hidden or Invisible: Gently flowing wisps of mist rise up and float in a circular motion.
Specific Spell Restriction: 303a stamped and gold-inked palimpsest First Person: Preparing [Spell Name], you solicit the spirits with a casual flick of the hand, and tendrils of sanguine thread appear, then wrap around your hand in an agonizingly painful bind before they fade away.
Third Person: Person casually flicks her hand, tendrils of sanguine thread appearing and then wrapping tightly around it before they fade away.
Hidden or Invisible: Tendrils of sanguine threading appear in the air, then move in an odd but clearly regular pattern before fading away.
Specific Spell Restriction: 214a lightly curled white paper First Person: Motes of pearly light dance across your fingers and splay out around you as you quietly, lullingly, whisper the incantation for [Spell Name].
Third Person: While Person whispers quietly, lullingly, motes of pearly light dance across her fingers and splay out around her.
Hidden or Invisible: Motes of pearly light dance through the air as quiet, lulling whispering floats through the area.
Specific Spell Restriction: 202a stylized argent-swirled parchment First Person: Tendrils of darksome mist gather about you, swirling upwards, as you beseech the lesser spirits for aid with the [Spell Name] spell...
Third Person: Tendrils of darksome mist gather about Person, swirling upwards as she beseeches the lesser spirits for aid...
Hidden or Invisible: You hear someone beseeching the lesser spirits for aid.
Specific Spell Restriction: 125lightly smudged palimpsest First Person: Murmuring an incantation for [Spell Name], you momentarily feel as if you are flying through the stars, darkness pressing in on you.
Third Person: Person's eyelids flicker rapidly and a star-pricked darkness flows across her skin as she murmurs a magical incantation.
Hidden or Invisible: You hear soft murmuring.
Specific Spell Restriction: 116a burnt-edged coal black paper First Person: Grating out a request to the nearby spirits, you leech upon their power for [Spell Name], your veins light up with a dim luminescence.
Third Person: Grating out an incomprehensible phrase, Person's eyes flash with power, her veins lighting up with a dim luminescence.
Hidden or Invisible: A dim luminescence glows briefly in the shape of a figure, then disappears.
Specific Spell Restriction: 103
Behind Brick
Behind brick: Circles 500-900
Spell preps all 750 BS
Behind the brick you see:
a double-thick ivory parchment First Person: A great mass of turbulent air roils before you as you invoke the phrase for [Spell Name]...
Third Person: A great mass of turbulent air roils before Person as she invokes a magical phrase.
Hidden or Invisible: You hear someone invoking a magical phrase.
Specific Spell Restriction: 912a heavily creased palimpsest First Person: As you draw heated power from the earth for the [Spell Name] spell, bits of flesh flake off of your skin, rising up into the air and turning to brightly burning cinders that whirl around you.
Third Person: Bits of flesh flake off of Person's skin, rising up into the air and turning to brightly burning cinders that whirl around her.
Hidden or Invisible: Brightly burning cinders whirl through the air.
Specific Spell Restriction: 917a gilt-edged cream vellum First Person: You feel energy ripple around you in chaotic waves, and you yank it toward you as you prepare the [Spell Name] spell.
Third Person: Person's eyes darken, then glow with chaotically shifting light, as she chants a magical phrase.
Hidden or Invisible: You hear someone chant a magical phrase.
Specific Spell Restriction: 905a thick rounded-edged paper First Person: Your eyes roll back into your head and your body heaves spasmodically as the invocation of the [Spell Name] spell issues from the rictus of your gaping mouth...
Third Person: Person's eyes roll back into her head and her body heaves spasmodically as an invocation issues from her gaping mouth.
Hidden or Invisible: You hear someone invoking a spell.
Specific Spell Restriction: 725a rough deep crimson papyrus First Person: The whites of your eyes glow a luminous green around the black depths of your pupils as you forcefully invoke [Spell Name]...
Third Person: The whites of Person's eyes glow a luminous green around the black depths of her pupils as she forcefully invokes a spell.
Hidden or Invisible: You hear someone forcefully invoking a spell.
Specific Spell Restriction: 713a delicately calligraphed parchment First Person: The flesh of your fingers blackens as you breathe in deeply, blood seeping out around your knuckles, then returns to normal as you focus on preparing [Spell Name].
Third Person: The flesh of Person's fingers blackens, blood seeping out around her knuckles as she breathes in deeply, then returns to normal.
Hidden or Invisible:
Specific Spell Restriction: 712a velvety garnet red scroll First Person: Your body flushes with a blood red hue, your veins standing out from your skin, as you incant a mantra for [Spell Name].
Third Person: Person's body flushes a blood red hue, her veins standing out from her skin and twisting her features, as she incants a mantra.
Hidden or Invisible: You hear a quiet incantation.
Specific Spell Restriction: 701a neatly inked cyan papyrus First Person: As you quickly call forth the [Spell Name] spell, variegated pale turquoise light encompasses your hands.
Third Person: As Person chants a magical phrase, variegated pale turquoise light encompasses her hands.
Hidden or Invisible: Variegated pale turquoise light briefly lights up the area.
Specific Spell Restriction: 619a forest green-stamped paper First Person: You envision a forest growing up around you, evergreen trees bending down toward you to listen to your incantation of [Spell Name].
Third Person: For just a moment, Person appears to be surrounded by evergreen trees bending toward her to listen to her magical incantation.
Hidden or Invisible:
Specific Spell Restriction: 605a pale red embossed parchment First Person: Barking an order at the ground below you to prepare the [Spell Name] spell, you feel it respond with a light tremble that sends a jolt of elemental energy racing through you.
Third Person: Person barks an order at the ground below her, and it trembles lightly in response.
Hidden or Invisible: The ground trembles lightly.
Specific Spell Restriction: 514a wavy-edged azure vellum First Person: Swiping your hand emphatically through the air, you deliberately slow its motion as you finish the stylized gesture for the [Spell Name] spell.
Third Person: Person swipes her hand emphatically through the air, her motion slowing significantly as she finishes the stylized gesture.
Hidden or Invisible:
Specific Spell Restriction: 504
On Brick
On brick: Circles 1000-1700, and ALL casting
Spell preps all 750 BS
On the brick you see:
a sickly pale green-hued paper First Person: Wisps of crimson light materialize in your palms, slowly floating into the air and disappearing as you chant the phrase for [Spell Name]...
Third Person: Wisps of crimson light materialize in Person's palms, slowly floating into the air and disappearing as she chants a phrase...
Hidden or Invisible: Wisps of crimson light float into the air.a broad lilac-outlined vellum First Person: A haze of black mist gathers around you as you prepare [Spell Name]...
Third Person: A haze of black mist gathers around Person as she prepares a spell...
Hidden or Invisible: A haze of black mist appears and slowly dissipates.an ivy-bordered painted vellum First Person: A haze of noxious vapor forms in the air overhead as you recite the esoteric command for [Spell Name]...
Third Person: A haze of noxious vapor forms in the air overhead as Person recites an esoteric command.
Hidden or Invisible: You hear someone reciting an esoteric command.
Specific Spell Restriction: 109a silver-sheened papyrus First Person: Waves of argentine light curl around you, embracing and seeping into you as you call upon your patron for [Spell Name].
Third Person: Waves of argentine light curl around Person, embracing and seeping into her as she calls upon her patron.
Hidden or Invisible: Waves of argentine light appear curl through the air until they disappear.
Specific Spell Restriction: 1615a small dagger-stamped scroll First Person: Calling forth the [Spell Name] spell with the intonation of a single syllable, a murky shroud peels away from you and vanishes.
Third Person: As Person intones a spell with a single syllable, a murky shroud peels away from her and vanishes.
Hidden or Invisible: You hear a single intoned syllable.
Specific Spell Restriction: 1606an off-white goatskin parchment First Person: Clearing your mind of all but the [Spell Name] spell, you touch the tips of your fingers together and focus on the single thought of terrible pain slicing outward from them.
Third Person: Person touches the tips of her fingers together, a cruel expression flitting across her features.
Hidden or Invisible:
Specific Spell Restriction: 1210a lightly stained vellum First Person: Crooning the [Spell Name] spell in an archaic tongue, you focus on the passage of time, quickly shuttering the past and the present away.
Third Person: As Person croons an archaic phrase, she stares off into the distance, her eyes briefly turning to pools of marbled argent.
Hidden or Invisible: You hear soft crooning sounds.
Specific Spell Restriction: 1204smooth cocoa-hued scroll First Person: As you raise your hands up to prepare the [Spell Name] spell and insistently beckon several spirits to you, the faint outlines of their caliginous shadows flutter in and out of sight.
Third Person: The faint outlines of caliginous shadows flutter in and out of sight around Person as she raises her hands in an insistently beckoning manner.
Hidden or Invisible: The faint outlines of caliginous shadows flutter in and out of sight.
Specific Spell Restriction: 1115a slender ruby-dusted palimpsest First Person: You close your eyes and focus on [Spell Name], envisioning how your limbs' anatomical structure -- the tendons, muscles, bones, blood vessels -- all work together in perfect harmony.
Third Person: Person closes her eyes, and the skin on her limbs briefly fades to transluscency, the anatomical structure -- the tendons, muscles, bones, blood vessels -- visible for a mere moment.
Hidden or Invisible:
Specific Spell Restriction: 1102a red and white-striped papyrus First Person: Drawing in a long breath to prepare [Spell Name], you eke out an off-key melody fit for shattering glass, and a sharp pain stabs your mind.
Third Person: Person draws in a long breath, her expression suddenly pained as she ekes out an off-key melody fit for shattering glass.
Hidden or Invisible: An off-key melody fit for shattering glass fills the air.
Specific Spell Restriction: 1019a blue block-lettered vellum First Person: Breaking into a tortured song for [Spell Name], you focus on crafting a tune rife with loathing and distress.
Third Person: Person breaks into a tortured song, crafting a tune rife with loathing and distress.
Hidden or Invisible: A tortured song drifts through the area, its tune rife with loathing and distress.
Specific Spell Restriction: 1001
Spellbound Crevice
[Spellbound, Crevice] | |
Collapsing cement blocks are surrounded by cascading dirt and debris that integrate into a filthy rubble at the base of the side wall. Imposing upon most of the space, a dilapidated birch shelf and a decaying oaken slab are haphazardly lodged in the cramped, dingy crevice. | |
Obvious exits: north |
On Shelf
Spell preps all 750 BS
On the birch shelf you see:
a translucent cream-hued vellum First Person: Closing your eyes tightly, you concentrate on an image within your mind's eye and murmur a soft prayer to the spirits. As the last syllable falls from your lips, your [eye color] eyes fly wide open and you flick your fingers, releasing the [Spell Name] spell...
Third Person: Closing his eyes tightly, Person appears to be concentrating for several seconds as he murmurs a soft prayer to the spirits. As the last syllable falls from his lips, his [eye color] eyes fly wide open and he flicks his fingers, releasing his spell.
Hidden or Invisible: [Eye color] light suddenly flashes in the air.
Specific Spell Restriction: 116a smooth off-white vellum First Person: Cajoling the lesser spirits, you utter a lyrical prayer that is accompanied by simple gestures. Your [eye color] eyes flash with a holy light as you release the [Spell Name] spell...
Third Person: Cajoling the lesser spirits, Person utters a lyrical prayer that is accompanied by simple gestures. His [eye color] eyes flash with a holy light as he releases his spell.
Hidden or Invisible: From somewhere nearby, the sound of someone cajoling the spirits with a lyrical voice can be heard.
Specific Spell Restriction: 103a silvery lightning-motif vellum First Person: Curling your fingers into claws, you forcefully confront the spirits and demand that they mold to your will. Zorchar energy crackles across the surface of your [complexion] skin as you release the stored energy of the [Spell Name] spell...
Third Person: Curling his fingers into claws, Person forcefully confronts the spirits and demands that they mold themselves to his will. Zorchar light crackles across the surface of his [complexion] skin as he releases the stored energy of his spell.
Hidden or Invisible: Zorchar energy crackles through the air.
Specific Spell Restriction: 125a small scale-shaped parchment First Person: Sibilantly forming the simple words of your [Spell Name], you implore shadows and darkness to protect you...
Third Person: Sibilantly forming the simple words of his prayer, Person implores shadows and darkness to protect him.
Hidden or Invisible: Sibilant prayers issue from the darkness.
Specific Spell Restriction: 303an inky black palimpest First Person: Flexing your fingers slightly, you summon the very essence of your spirit to the surface of your form and feel inky shadows within you respond. Slowly, darkness seeps from your [eye color] eyes and transforms into a [Spell Name] before you...
Third Person: Flexing his fingers slightly, Person's form begins to darken and shadows seep from his [eye color] eyes. Person releases his spell by transforming that darkness around him into a spiritual shield.
Hidden or Invisible: Darkness briefly pools about the area.
Specific Spell Restriction: 202a thin shadowy black parchment First Person: Tenebrous shadows slip across your [complexion] skin as you demand divinity to heed your prayers. As if in answer, a darkness falls across your vision and you release your [Spell Name]...
Third Person: Tenebrous shadows slip across Person's [complexion] skin as he demands divinity to heed his prayers. As if in answer, his [eye color] eyes briefly blacken as he releases his fury.
Hidden or Invisible:
Specific Spell Restriction: 317
On Slab
Spell preps all 750 BS
On the oaken slab you see:
a coin-edged piece of sheet music First Person: Humming a familiar ditty about a knave found on the wrong side of a door, you weave the simple somatic components of [Spell Name] into the air...
Third Person: Humming a familiar ditty about a knave found on the wrong side of a door, Person weaves the simple somatic components of a spell into the air.
Hidden or Invisible: Rising on the air is a familiar ditty.
Specific Spell Restriction: 403a sheet of watermarked music First Person: Lifting your voice in song, you spin a quick tale involving a small child trying to discover the mysteries of water elementals. As you sing, you weave your fingers in a complicated pattern that mimics the cadence of your tune and cast [Spell Name] in the process...
Third Person: Lifting his voice in song, Person spins a quick tale involving a small child trying to discover the mysteries of water elementals. As he sings, he weaves his fingers in a complicated pattern that mimics the cadence of his tune and in the process, casts a spell.
Hidden or Invisible: A simple song about a small child trying to discover the mysteries of water elementals rises on the air.
Specific Spell Restriction: 405a violet cotton sheet First Person: Tracing simple lines upon your [complexion] brow, you invoke the elements and implore them to give you deeper insight. Within seconds, a third [eye color] eye opens in your forehead as you cast the [Spell Name] spell. The eye fades in a matter of moments...
Third Person: Tracing simple lines upon his [complexion] brow, Person invokes the elements and almost instantly a third [eye color] eye opens in his forehead. Seconds after he releases the spell, the eye fades away.
Hidden or Invisible:
Specific Spell Restriction: 416a soft sigil-etched sheet First Person: Tracing sigils in the air, each illuminating in various brilliant hues, you invoke the elements to provide [Spell Name] around you...
Third Person: Tracing sigils in the air, each briefly illuminating in various brilliant hues, Person invokes the elements as he casts his spell.
Hidden or Invisible:
Specific Spell Restriction: 419a whorl-edged cloud white note First Person: Drawing arcane energy about you, you trace your fingers through the elemental mana of the world, and it feels as if you are pulling your fingers through mud. Gradually, the world around you becomes sluggish as you complete the somatic components of the [Spell Name] spell...
Third Person: Drawing his fingers through the air, Person's movements gradually become sluggish as he finishes the somatic components of his spell.
Hidden or Invisible:
Specific Spell Restriction: 504
Bolt From The Blue Entry
Updated 8/21/2019
[Bolt From The Blue] | |
The narrow walls are painted in shades of midnight blue and stormy grey, the paler hues sweeping in spiraling arcs around a rectangular seascape painting at the back. On opposite sides of the room, a dark-grained mistwood case and a carved white pine chest symmetrically mirror the position of a broad willow-planked hutch, each container illuminated by a solitary hanging silver lantern. | |
Obvious exits: south, out |
Premade bolt messaging, 2500 BS
In the mistwood case you see:
a dark gale token Hand of Tonis (505) You exhale a precisely controlled gale at a giant rat! a frosty air token You project a wildly churning cyclone of frosty air at a giant rat! a torrid air token You propel forth a violently whipping wall of scorching torrid air at a giant rat! a silky webbing token Web (118) You emit fine, silky threads that twist into a coating of sticky webbing at a giant rat! a silver-white water token Holy Bolt (306) You launch a zealous torrent of pure silver-white water at a giant rat! a scintillating water token You conjure a surge of scintillating water at a giant rat! an intense copper fireball token Balefire (713) You swiftly summon an undulating intense copper fireball at a giant rat! a puffed fiery token You belch forth a roaring puff of virulent balefire at a giant rat! a hole-riddled crag token Hurl Boulder (510) You fling a bulky hole-riddled crag at a giant rat! a spiraling whirlwind token Cone of Elements (518) (Air Only) You summon a spiraling whirlwind of riotous air at a giant rat! an opalescent viridian light token Disintegrate (705) You boldly summon a sidewinding opalescent viridian light at a giant rat! a fractured yellow ray token You project a fractured ray of sickly yellow radiance at a giant rat! a sparking fire orb token Fire Spirit (111) You pitch a vividly sparking orb of pure crimson fire at a giant rat! a spherical niveous fire token You smoothly conjure a hazy sphere of glowing niveous fire at a giant rat! In the white pine chest hutch you see:
an incandescent rune token Minor Shock (901) You draw a sinuous incandescent rune at a giant rat! an ivory spark token You flick a shower of radiant ivory sparks at a giant rat! a white spherical token Minor Shock (901) You sharply wave a hand, conjuring a surge of pure white electrified spheres at a giant rat! a red spherical token blood red a black spherical token silvery black a violet spherical token stormy violet a green spherical token forest green an orange spherical token deep orange a yellow spherical token vivid yellow a jade green lightning rune Major Shock (910) You release a broken chain of jade green lightning at a giant rat! a copper lightning rune You conjure an outburst of radiant copper lightning strikes at a giant rat! a dark amber lightning rune You conjure a crackling cloud of dark amber lightning at a giant rat! an emerald lightning rune You conjure a sizzling bolt of intense emerald lightning at a giant rat! a crimson lightning rune You conjure a shifting lattice of fiery crimson lightning at a giant rat! an amethyst lightning rune You conjure a crackling burst of amethyst-hued lightning at a giant rat! a midnight blue lightning rune You conjure a vicious spray of midnight blue lightning forks at a giant rat! a niveous lightning rune You conjure a sharply darting branch of niveous lightning at a giant rat! an ebon lightning rune You conjure a rotating sphere of silver-forked ebon lightning at a giant rat! a sparking arc rune You release a broadly strewn arc of sparking electricity at a giant rat! a hissing sigil rune You project a hissing sigil composed of undulating energy at a giant rat!
In the willow-planked hutch you see:
a churning fog bauble Minor Steam (1707) You propel a churning wall of dense stone grey fog at a giant rat! a steam bauble You summon a blistering wave of steam at a giant rat! an opaque steam bauble You exhale a profuse outpouring of opaque steam at a giant rat!
BftB Niche
[Bolt From The Blue, Niche] | |
A faint note of ozone hangs lightly in the air, aptly playing off the sky blue tones used in the niche's interior. Finely honed woodworking skills are presented in the forms of a glossy mahogany counter and a lacquered oak table placed at the center of the space. Stacked neatly at the back, some golden spinewood crates sit next to an oversized iron-bound trunk that is incised with an array of silvery glyphs and symbols. | |
Obvious exits: north, west |
Premade bolt messaging, 2500 BS
On the mahogany counter you see:
a snow-coated stone ornament Minor Cold (1709) You summon a massive snow-coated stone at a giant rat! a ridged ice crag ornament You conjure an immense frost-ridged ice crag at a giant rat! a serrated blue icicle trinket Major Cold (907) You thrust a serrated ring of pale blue icicles at a giant rat! an icy hoarfrost trinket You summon a rapid downpouring of icy hoarfrost at a giant rat! a fragmented hailstone trinket You let fly a slushy mix of icy fragments and hailstone at a giant rat! On the oak table you see:
an iridescent statue Empathic Assault (1110) You summon a threadlike interlacing of iridescent plasma at a giant rat! an opaline white statue You conjure a wavy-edged aura of opaline white energy at a giant rat! a sheer white globe statue Empathic Assault (1110) You conjure a shifting globe of sheer white plasma at a giant rat! a fiery red globe statue fiery red a royal purple globe statue royal purple a jet black globe statue jet black an aloeas green globe statue aloeas green a coral orange globe statue coral orange an ocean blue globe statue ocean blue pallid gold globe statue pallid gold In the spinewood crates you see:
an acrid mist token Minor Acid (904) You spray forth a hazy, acrid mist at a giant rat! an intense green liquid token You summon a current of noxious intense green liquid at a giant rat! a yellow-green fluid token You belch a shower of acerbic yellow-green fluid at a giant rat! a pea green acid token You direct a strong wave of pea green acid at a giant rat! a muddled acid token You spit a muddled spray of bitter acid at a giant rat! a chaotic liquid token You direct a chaotic stream of erosive liquid at a giant rat! a blue-green gob token You hawk loudly and spit a strikingly blue-green gob of phlegm at a giant rat! a caustic mist stone Major Acid (1710) You project a seething onslaught of caustic mist at a giant rat! a dark miasma stone You exhale a powerfully acidulous dark miasma at a giant rat! a green miasma stone You throw a green orb of hissing miasma at a giant rat! a caustic orb stone You exhale a caustic green orb at a giant rat! In the iron-bound trunk you see:
a flame glyph button Major Fire (908) You project a glyph wrought of ash-traced flame at a giant rat! a white-gold fireball button You loudly belch a spinning white-gold fireball at a giant rat! a curved flame button You exhale a wicked curvation of white-hot flames at a giant rat! a bonfire flames button You breathe a bonfire-sized collection of gold flames at a giant rat! an arched flame button You emit a sulphur-scented arch of sanguine flame at a giant rat! a molten sputum button You hawk up and spit a smoldering gob of molten-laden sputum at a giant rat! a shield of fire token You smoothly conjure an undulating shield of scorching fire at a giant rat!! a panel of fire button You swiftly conjure a vacillating panel of searing blue fire at a giant rat! a rondure of ivory fire button Major Fire (908) You summon a luminous rondure of searing ivory fire at a giant rat!! a rondure of silver fire button silver a rondure of golden fire button golden a rondure of dark lilac button dark lilac a rondure of indigo fire button indigo a rondure of verdigris fire button verdigris a rondure of titian fire button titian a rondure of honeyed fire button honeyed
BftB Nook
[Bolt From The Blue, Nook] | |
Ivory-swept dark grey silk walls wrap around the semi-circular nook area, providing a pleasingly stark backdrop for a pewter-set ivory stand and a beveled ironwood sideboard. Tiny clusters of silvery lights are suspended in a gentle wave configuration from the ceiling, illuminating an ornate willow receptacle resting in the middle of the room. | |
Obvious exits: east |
Premade bolt messaging, 2500 BS
On the ivory stand you see:
a prismatic coin Arcane Blast (1700) You fling a fragment of prismatic-threaded energy at a giant rat! On the ironwood sideboard you see:
a lava rune charm Minor Fire (906) You fling a coursing flood of lava-dripping runes at a giant rat! an effulgent flames charm You spew a bevy of effulgent tridented flames at a giant rat! a red-hot flame charm You blow a broiling red-hot sequence of flaming symbols at a giant rat! a cascading white fire charm Minor Fire (906) You emanate a mercurial cascade of harshly snapping white fire at a giant rat! a cascading red fire charm red a cascading black fire charm black a cascading blue fire charm blue a cascading purple fire charm purple a cascading green fire charm green a cascading orange fire charm orange a cascading yellow fire charm yellow a wyvern flame charm Minor Fire (906) You summon a flame-cloaked semblance of a smoldering wyvern at a giant rat! a basilisk flame charm basilisk a skayl flame charm skayl In the willow receptacle you see:
a gushing geyser token Minor Water (903) You expertly direct a gushing geyser of clear water at a giant rat! a frothy wave token You summon a rushing wave of frothy water at a giant rat! a vaporous glyph token You artfully draw a fluent strand of vaporous glyphs at a giant rat!
Spellbound Archive, the before times
The scrolls are unlockable, infusable, and come with 40 charges per spell off-the-shelf. To calculate the silver value, multiply the scrip cost by 100.
Spellbound Entry
In Crate
Item | Bloodscrip | Info |
---|---|---|
a carved jade leaf pin | 7500 | 1x/day Mobility |
a stylized pewter fist pin | 7500 | 1x/day Dauntless |
a translucent glass pin | 7500 | 2x/day Invisibility |
an enruned mithril disk pin | 7500 | 2x/day Floating Disk |
a slit-pupiled citrine quartz pin | 15000 | 1x/day Fash'lo'nae's Gift |
a ivy-traced green spell book | 2750 | (605) Whispering Willow (606) Phoen's Strength (608) Camouflage (613) Self Control (618) Mobility |
a blood-stained crimson spell book | 4750 | (1101) Heal (1107) Adrenal Surge (1109) Empathic Focus (1118) Herb Production (1119) Strength Of Will |
a silver-edged purple spell book | 3750 | (905) Prismatic Guard (913) Melgorehn's Aura (916) Invisibility (918) Duplicate (919) Wizard's Shield |
an embossed dark gold spell book | 4000 | (402) Presence (418) Mana Focus (507) Elemental Deflection (508) Elemental Bias (515) Rapid Fire |
a glittering silver spell book | 5000 | (110) Unbalance (116) Locate Person (120) Lesser Shroud (211) Bravery (215) Heroism |
a gilt-edged white spell book | 7500 | (304) Bless Item (305) Preservation (308) Well of Life (310) Warding Sphere (318) Raise Dead |
12/11/2016 Update
In the Common language, it reads: The wand/rod/baton can be used once a day. Enruned witchwood rod: 507, 508, 905 Sigil-encised wand: 1705, 1712, 1701 Heavy crystal baton: 1720, 1711 Items with x/day details: Bracer - 1x - Dragonclaw Armband - 2x - Resist Elements Bandage - 5x - Heal II Scepter - 1x - Spirit Shield Pin - 2x - Poison Resist Magic-filled puzzles contain 20 charges of each spell, but must be solved to unlock their power: Sphere: 211, 509, 506 Pyramid: 101, 107, 508 Cube: 202, 503, 507
In the rune-covered wooden crate you see:
a claw-clasped wide leather bracer 1x/day Dragonclaw (1209) 7500 a leather armband adorned with seed pearls and sapphires 2x/day Resist Elements (602) 7500 a tattered wool bandage 5x/day Heal II (806) 10500 a silver scepter adorned with a ruby-inlaid double helix 1x/day Spirit Shield (202) 7500 an eahnor-tongued patinaed asp pin 2x/day Poison Resistance (105) 7500 a heavy crystal baton 12500 a sigil-incised golden wand 12500 an enruned witchwood rod 12500 a striated wooden sphere 500 a small oak pyramid 500 a silk-covered cube 500
Behind Brick
Spell Preps (Invoke to apply to a character) | ||
---|---|---|
Item | Bloodscrip | Info |
a silver-inked vellum parchment | 750 | First Person: You command the elements, a silver-hued fist appearing in the air above your hand... Third Person: Tei commands the elements, a silver-hued fist appearing in the air above her hand... Hidden or Invisible: Specific Spell Restriction: 407 |
a verdant green-inked parchment | 750 | First Person: In hushed tones, you quell and quiet the local spirits to mask your passage... Third Person: In hushed tones, Tei quells and quiets the local spirits... Hidden or Invisible: Specific Spell Restriction: 617 |
a thin leather-bound tome | 750 | First Person: Your field of vision begins to rapidly vibrate, then shrinks as you prepare the Eye Spy spell... Third Person: Tei's eyes begin to vibrate and her pupils shrink to black slivers as she prepares a spell... Hidden or Invisible: Specific Spell Restriction: 707 |
an ebon-inked vellum tome | 750 | First Person: The shadows darken and engulf you, flowing around your shoulders as you prepare the Cloak of Shadows invocation... Third Person: The shadows darken and engulf Tei, flowing around her shoulders as she prepares an invocation... Hidden or Invisible: Specific Spell Restriction: 712 |
a thin dog-eared papyrus | 750 | First Person: You quietly utter an incantation as you prepare the [Spell Name] spell... Third Person: Tei quietly utters an incantation as she prepares a spell... Hidden or Invisible: You hear a quietly uttered incantation. |
a crumpled coffee-stained papyrus | 750 | First Person: You murmur softly under your breath, preparing the [Spell Name] spell... Third Person: Tei murmurs softly under her breath, preparing a spell... Hidden or Invisible: You hear a soft murmuring. |
12/11/2016 Update
a stamped cream papyrus | First Person: All casting: You toss your head back and howl loudly as swirling wisps of mana flow out of thin air and into your mouth, spiraling downward to fill your lungs with power... Third Person: <Player> tosses his/her head back and howls loudly as swirling wisps of mana flow out of thin air and into his/her mouth... Hidden or Invisible: You hear a loud howl followed by swirling wisps of mana appearing and vanishing. |
750 |
a thin onion skin paper | First Person: You chant a short mantra as you focus your thoughts on the rigidity of steel and iron... Third Person: <Player> chants a short mantra, focusing his/her thoughts... Hidden or Invisible: You hear someone chanting a short mantra. Specific Spell Restriction: 1202 |
750 |
a charred red-inked parchment | First Person: Invoking the power of your patron, you prepare to break a curse... Third Person: Invoking the power of his/her patron, <player> chants a short prayer... Hidden or Invisible: You hear a faint whisper. Specific Spell Restriction: 315 |
750 |
a scallop-edged white palimpsest | First Person: Thin, straight grey lines cover the palms of your hands as you prepare the Disintegrate spell... Third Person: Thin, straight grey lines cover the palms of <player's> hands... Hidden or Invisible: Specific Spell Restriction: 705 |
750 |
a gold-lettered black vellum | First Person: Spirits swirl around you, shrouding your form partially as you prepare the Unpresence spell... Third Person: Spirits swirl around <player>, shrouding his/her form partially as he/she utters a short phrase... Hidden or Invisible: Specific Spell Restriction: 204 |
750 |
Under Brick
12/11/2016 Update
In the Common language, it reads: On the shelf you'll find containers for your jewels and alchemy ingredients and some very fancy books. In the crate you will find some magic-filled puzzles and other items, detailed below. Spell prep phrases are behind the brick and are as follows: Cream papyrus: All casting Onion skin paper: Iron Skin Red-inked parchment: Remove Curse White palimpsest: Distintegrate Black vellum: Unpresence Items with x/day details: Bracer - 1x - Dragonclaw Armband - 2x - Resist Elements Bandage - 5x - Heal II Scepter - 1x - Spirit Shield Pin - 2x - Poison Resist Rod - 1x - 507, 508, 905 Wand - 1x - 1705, 1712, 1701 Baton - 1x - 1720, 1711)
On Shelf
12/11/2016 Update
a rat-shaped gold pattern | gemcutter pattern | 100 | |
a tarnished rat catcher statue | gemcutter | 500 | |
a gold-banded short glass jar | Pocketed:VSA (<2-4) one item |
100-ct | 250 |
a hexagonal golden glass bottle | Pocketed:VSA (<2-4) one item |
100-ct | 250 |
a vaalin-banded square glass jar | Pocketed:VSA (<2-4) one item |
50-ct | 100 |
a silver-hued tall glass bottle | Pocketed:VSA (<2-4) one item |
50-ct | 100 |
a gold-spined thick leather codex | heavily scripted | 2000 | |
an enruned leather-bound tome | heavily scripted | 2000 |
8/22/2017 Update
a dwarven archaeologist figurine | gemcutter | 500 | |
a moon-shaped mithril pattern | gemcutter pattern | 100 |
In Case
8/19/2017 Update
Items in the case are 1x/day with details: Rod: Patron's Blessing (1611) Orb: Force Projection (1207) Globe: Major Sanctuary (220) Eye: Higher Vision (1610) Figurine: Zealot (1617) Stone: Crusade (1618) Cube: Benediction (307) Baton: Elemental Focus (513) Stake: Self Control (613) Trinket: Melgorehn's Aura (913) Chunk: Strength of Will (1119) Cloth: Blink (1215) Charm: Dragonclaw (1209) Scepter: Mage Armor (520)
In the sigil-incised display case you see:
a lightning bolt-shaped blued steel rod 1x/day Patron's Blessing (1611) 16000 a large green glaesine orb with a rippled surface 1x/day Force Projection (1207) 4000 a flawless clear glass globe 1x/day Major Sanctuary (220) 20000 a large obsidian eye set with an aster opal iris 1x/day Higher Vision (1610) 12000 a miniature red-cloaked orc figurine 1x/day Zealot (1617) 16400 a circular grey stone chiseled outward into numerous radiant points 1x/day Crusade (1618) 12000 a pearl-edged white ora cube engraved with variegated symbols 1x/day Benediction (307) 13000 a short gold-leafed navy blue baton 1x/day Elemental Focus (513) 15000 a long wooden stake with a dull blackened tip 1x/day Self Control (613) 13400 a small polychromatic trinket 1x/day Melgorehn's Aura (913) 12000 a grimy chunk of petrified wyrwood 1x/day Strength of Will (1119) 12000 a shred of soft purple cloth 1x/day Blink (1215) 8000 a ruby-inset charm dangling two silver talons 1x/day Dragonclaw (1209) 9300 a pitch black twisted mithril scepter 1x/day Mage Armor (520) 20000
Behind Case
2/18/2018 Update
Items behind the case are illusion pins. The base item (only) can be freely altered by any willing merchant. These items can also be hidden using COVER while worn. There is one for each element as follows: Trinket: lava Charm: sand Pin: mud Pendant: acid Brooch: steam Droplet: water
Behind the sigil-incised display case you see:
a small crystal water droplet edged in deep blue tones Water: Glistening water drops hover in a constantly shifting halo around him/her. pin-worn 10000 a gold-speckled white opal teardrop brooch Steam: Churning droplets shroud him/her and glimmer faintly with the heat of a mirage. a smoke-filled glass orb pendant Acid: A hazy miasma of verdant droplets swirls chaotically around him/her. a muddy garden pin Mud: Muddy droplets churn in an earthen haze around him/her. a pearlescent seashell charm Sand: Golden sand whirls loosely around him/her in a hazy shroud. a jagged volcanic rock trinket Lava: Globules of molten rock form a dimly glowing halo around him/her.
Bolt From The Blue Entry
2/19/2018 Update
- Mostly a redistribution of wares between containers in the BftB rooms.
In the mistwood case you see:
Premade bolt messaging, 2500 BS
a blue-white flickering fire token Fire Spirit (111) You hurl a flickering ball of blue-white fire at a giant rat!
Person hurls a flickering ball of blue-white fire at a giant rat!a white web token Web (118) You shoot thin, silken strands of sticky white webbing at a giant rat!
Person shoots thin, silken strands of sticky white webbing at a giant rat!a radiant-white whorled water token Holy Bolt (306) You toss radiant-white whorled water at a giant rat!
Person tosses radiant-white whorled water at a giant rat!an incandescent water token You conjure a stream of incandescent water at a giant rat!
Person conjures a stream of incandescent water at a giant rat!a geyser token Minor Water (903) You direct a geyser of water at a giant rat!
Person directs a geyser of water at a giant rat!a wave token You summon a small wave of water at a giant rat!
Person summons a small wave of water at a giant rat!In the white pine chest you see:
Premade bolt messaging, 2500 BS
a white pale fire token Fire Spirit (111) You conjure a pale orb of white fire at a giant rat!
Person conjures a pale orb of white fire at a giant rat!a green light token Disintegrate (705) You summon a sidewinding green light at a giant rat!
Person summons a sidewinding green light at a giant rat!a dark green fireball token Balefire (713) You summon a dark green fireball at a giant rat!
Person summons a dark green fireball at a giant rat!a small orb of white lightning token Minor Shock (901) You conjure a small orb of {white} lightning at a giant rat!
Person conjures a small orb of {white} lightning at a giant rat!a small orb of red lightning token red a small orb of black lightning token black a small orb of purple lightning token purple a small orb of green lightning token green a small orb of orange lightning token orange a small orb of yellow lightning token yellow a white-hot fireball button Major Fire (908) You belch a white-hot fireball at a giant rat!
Person belches a white-hot fireball at a giant rat!a flame sigil button You project a sigil wrought of smoke and flame at a giant rat!
Person projects a sigil wrought of smoke and flame at a giant rat!a black spark rune Major Shock (910) You conjure a crackling orb of {black} lightning at a giant rat!
Person conjures a crackling orb of {black} lightning at a giant rat!a white spark rune white a blue spark rune blue a purple spark rune purple a red spark rune red a green spark rune green a yellow spark rune yellow an orange spark rune orange In the willow-planked hutch you see:
Premade bolt messaging, 2500 BS
a gust of air token Hand of Tonis (505) You exhale a powerful gust of air at a giant rat!
Person exhales a powerful gust of air at a giant rat!a frigid air token You project a frigid blast of air at a giant rat!
Person projects a frigid blast of air at a giant rat!a howling air token You propel a howling blast of air at a giant rat!
Person propels a howling blast of air at a giant rat!an air vortex token Cone of Elements (518) (Air Only) You summon a tightly focused vortex of air at a giant rat!
Person summons a tightly focused vortex of air at a giant rat!a cloud bauble Minor Steam (1707) You exhale a seething blast of steam at a giant rat!
Person exhales a seething blast of steam at a giant rat!a steam bauble You summon a blistering wave of steam at a giant rat!
Person summons a blistering wave of steam at a giant rat!a rolling fog bauble You propel a roiling wave of hissing fog at a giant rat!
Person propels a roiling wave of hissing fog at a giant rat!a craggy rock token Hurl Boulder (510) You conjure a massive craggy rock at a giant rat!
Person conjures a massive craggy rock at a giant rat!a smoldering orb button Major Fire (908) You exhale a smoldering orb of flames at a giant rat!
Person exhales a smoldering orb of flames at a giant rat!
BftB Niche
2/19/2018 Update
- Mostly a redistribution of wares between containers in the BftB rooms.
On the mahogany counter you see:
Premade bolt messaging, 2500 BS
a radiant spark token Minor Shock (901) You flick a radiant spark at a giant rat!
Person flicks a radiant spark at a giant rat!a hissing fluid token Minor Acid (904) You direct a stream of caustic, hissing fluid at a giant rat!
Person directs a stream of caustic, hissing fluid at a giant rat!a blue ice orb trinket Major Cold (907) You summon a glistening orb of blue ice at a giant rat!
Person summons a glistening orb of blue ice at a giant rat!a blistering orb trinket You summon a blistering cold orb at a giant rat!
Person summons a blistering cold orb at a giant rat!an icy shard trinket You let fly a fractured stream of icy shards at a giant rat!
Person lets fly a fractured stream of icy shards at a giant rat!a kaleidoscopic coin Arcane Blast (1700) You fling a mote of kaleidoscopic energy at a giant rat!
Person flings a mote of kaleidoscopic energy at a giant rat!a craggy ice chunk ornament Minor Cold (1709) You conjure a craggy ice chunk at a giant rat!
Person conjures a craggy ice chunk at a giant rat!a jagged snowy rock ornament You summon a jagged snow-covered rock at a giant rat!
Person summons a jagged snow-covered rock at a giant rat!a bilious miasma stone Major Acid (1710) You exhale a dark and bilious miasma at a giant rat!
Person exhales a dark and bilious miasma at a giant rat!a green miasma stone You throw a green orb of hissing miasma at a giant rat!
Person throws a green orb of hissing miasma at a giant rat!On the oak table you see:
Premade bolt messaging, 2500 BS
a greenish brown acid token Minor Acid (904) You direct a stream of greenish brown acid at a giant rat!
Person directs a stream of greenish brown acid at a giant rat!a caustic green liquid token You summon a stream of caustic green liquid at a giant rat!
Person summons a stream of caustic green liquid at a giant rat!a green acid token You belch caustic green liquid at a giant rat!
Person belches caustic green liquid at a giant rat!an acrid mist token You spray forth a hazy, acrid mist at a giant rat!
Person sprays forth a hazy, acrid mist at a giant rat!an acid spray token You spit a messy spray of bitter liquid at a giant rat!
Person spits a messy spray of bitter liquid at a giant rat!a phoenix flame token Minor Fire (906) You summon flame-wrought semblance of a {phoenix} at a giant rat!
Person summons flame-wrought semblance of a {phoenix} at a giant rat!a dragon flame token dragon a drake flame token drake a translucent statue Empathic Assault (1110) You summon a translucent orb of shifting plasma at a giant rat!
Person summons a translucent orb of shifting plasma at a giant rat!a pure white statue You conjure a shifting orb of pure white energy at a giant rat!
Person conjures a shifting orb of pure white energy at a giant rat!a white statue Empathic Assault (1110) You conjure a shifting orb of {white} plasma at a giant rat!
Person conjures a shifting orb of {white} plasma at a giant rat!a red statue red a purple statue purple a black statue black a green statue green an orange statue orange a blue statue blue a yellow statue yellow a caustic orb stone Major Acid (1710) You exhale a caustic green orb at a giant rat!
Person exhales a caustic green orb at a giant rat!an acrid mist stone You project a hissing torrent of acrid mist at a giant rat!
Person projects a hissing torrent of acrid mist at a giant rat!In the spinewood crates you see:
Premade bolt messaging, 2500 BS
a scintillating rune token Minor Shock (901) You draw a thready, scintillating rune at a giant rat!
Person draws a thready, scintillating rune at a giant rat!a vaporous rune token Minor Water (903) You draw a fluid string of vaporous runes at a giant rat!
Person draws a fluid string of vaporous runes at a giant rat!a flaming rune charm Minor Fire (906) You fling a flickering stream of flaming runes at a giant rat!
Person flings a flickering stream of flaming runes at a giant rat!a splintered arc rune Major Shock (910) You release a splintered arc of searing electricity at a giant rat!
Person releases a splintered arc of searing electricity at a giant rat!a crackling sigil rune Major Shock (910) You project a complex sigil composed of crackling energy at a giant rat!
Person projects a complex sigil composed of crackling energy at a giant rat!a frayed beam token Disintegrate (705) You project a frayed beam of sickly luminescence at a giant rat!
Person projects a frayed beam of sickly luminescence at a giant rat!In the iron-bound trunk you see:
Premade bolt messaging, 2500 BS
a jet of white fire charm Minor Fire (906) You breathe a jet of sizzling {white} fire at a giant rat!
Person breathes a jet of sizzling {white} fire at a giant rat!a jet of red fire charm red a jet of black fire charm black a jet of purple fire charm purple a jet of blue fire charm blue a jet of green fire charm green a jet of orange fire charm orange a jet of yellow fire charm yellow an orb of white fire button Major Fire (908) You summon a fiery orb of {white} fire at a giant rat!
Person summons a fiery orb of {white} fire at a giant rat!an orb of red fire button red an orb of black fire button black an orb of purple fire button purple an orb of blue fire button blue an orb of green fire button green an orb of orange fire button orange an orb of yellow fire button yellow